(data stored in ACNUC9435 zone)

EMBL: CP000904.PE116

CP000904.PE116       Location/Qualifiers
FT   CDS_pept        163597..164052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_2285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5560"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46540"
FT                   /db_xref="InterPro:IPR031998"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG9"
FT                   /protein_id="ABY46540.1"
FT                   /translation="MDIIGALTIGGSVFSYTAGGITPASAESQFIQKVSPVFDDWQWQN
FT                   YFSLHHNADFLQELALGDLKQGDTFDIRIYTGGKDTGIVKIYRLSEDENEVVNMQRYKT
FT                   IYDTGTKHNYGRFVTPITSVYKPGSYVAVMKLGENYYYYGGSFKIKK"
     atggatataa ttggagcatt aactattgga ggaagtgtat tttcctatac tgcaggaggc        60
     attacacctg cttctgctga atctcaattt atacagaaag tatcaccggt ttttgatgac       120
     tggcaatggc aaaactattt ttcactccat cataatgcag acttcttaca agaattagcc       180
     cttggtgatt tgaagcaagg agatactttt gacattagaa tttatacagg tggtaaagat       240
     acaggtattg taaagatata tcgattaagt gaagatgaga atgaagtagt aaatatgcaa       300
     agatataaaa caatatatga tactggtact aagcataatt atggtagatt tgtaacacct       360
     attacatcag tttataagcc aggatcatat gtagctgtta tgaaacttgg agaaaattat       420
     tattattatg gtggcagctt taaaattaaa aaataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page