(data stored in ACNUC9435 zone)

EMBL: CP000904.PE117

CP000904.PE117       Location/Qualifiers
FT   CDS_pept        complement(164233..164703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3298 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5561"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46541"
FT                   /db_xref="GOA:A9VUH0"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH0"
FT                   /protein_id="ABY46541.1"
FT                   /translation="MPAAKNIFLQCFHYLHYNVVFLSVLIALTTFNGTSNPIENEGMTN
FT                   MFLKTPGIAIQLFGENIMFVSILFIWHKIIRSFIISPIPSITTSLILSGSSFGLLHLST
FT                   YNYNWVQCLAIIGIPAIAQMIFFLIFKNIHMGYMVHFNYNLIIILFNYIVSI"
     ttgccggcag ctaaaaacat ctttcttcag tgctttcatt atttacatta taatgttgtt        60
     tttttgtctg tactaatagc tcttacaaca ttcaatggaa catctaaccc cattgaaaat       120
     gaagggatga ccaatatgtt ccttaaaacg cctggtattg caattcaatt atttggtgag       180
     aacattatgt ttgtatctat attattcatt tggcacaaaa tcatacgttc cttcataata       240
     agtcccattc cttcaattac aacctcttta attttgtctg gaagctcatt tggactactc       300
     catctttcta catataatta taattgggtg caatgtttag ctatcatcgg tataccagct       360
     atcgctcaaa tgattttctt tctaatattt aaaaatattc atatgggata tatggttcac       420
     ttcaattaca atttaatcat catacttttt aactacatag tttctattta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page