(data stored in ACNUC9435 zone)

EMBL: CP000904.PE118

CP000904.PE118       Location/Qualifiers
FT   CDS_pept        complement(166054..166989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5563"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bce:BC1063 transporter,
FT                   drug/metabolite exporter family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5563"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46542"
FT                   /db_xref="GOA:A9VUH1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH1"
FT                   /protein_id="ABY46542.1"
FT                   /translation="MIQQNSIERKSLPALKMIISMVIFGSVGFFSVQTNLPSFELVFVR
FT                   CIFATIFLGLCWLITGQYKHDKWERKEVIQVLICGFFLVFNWVFLFKAFENMSVTVAIS
FT                   VYHLAPIIVLIIGSIVFKEKLTVLSVISIIICFVGALLIAGINKNFSFDSLMSSGMVWG
FT                   LLAALFYAFTTLFGKGIKNMSAYAMTFLQTFLGIFLLIPFIDFDAFHGLTQSNWTYIIA
FT                   TGLIHTGLVYYLFFDSLRDLSTKLISILVFLDPAVAILLDTVLTGFRPTLMQVSGITLI
FT                   FVGMALTFKKSKNKTQKFKKQTIEDDARVL"
     ttgattcaac aaaattctat tgagagaaaa tcattaccgg ctttgaagat gataatatca        60
     atggttattt tcggttcagt cggctttttt tccgtacaaa caaatttacc ttcatttgag       120
     ttggtatttg tacgatgcat ttttgctaca atatttttag gtctatgctg gctaattact       180
     ggacagtaca aacatgataa atgggaacga aaagaagtta ttcaagtctt gatatgtgga       240
     tttttccttg tatttaattg ggtattttta tttaaagcgt ttgaaaatat gtcagtcaca       300
     gttgcaatat cagtctatca ccttgctcca ataattgtac ttatcattgg aagtattgtt       360
     tttaaagaaa aattaacagt attatctgtt atctctatca ttatctgctt tgtaggagcg       420
     ttattaatcg ctggcataaa caaaaacttc tctttcgact cgttaatgtc ttctggcatg       480
     gtttggggac ttctcgcagc tctgttttat gcatttacaa ctttatttgg gaaaggtatt       540
     aagaacatga gtgcttatgc aatgaccttt ttgcaaacat ttttagggat ttttcttcta       600
     atacccttta tagattttga tgcattccat ggactgactc aaagtaattg gacgtatatt       660
     atagcaaccg gccttatcca tacaggattg gtatactact tattctttga tagcttacgt       720
     gatttatcaa caaaattaat ctcgatatta gtttttttag atccagctgt agcaatttta       780
     ttggacacgg tgcttacagg attccgacca actttaatgc aagtatcagg gattactcta       840
     atttttgttg gtatggctct aactttcaaa aaatctaaaa ataagaccca aaaatttaaa       900
     aaacaaacta tagaagacga cgctcgtgta ttgtaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page