(data stored in ACNUC9435 zone)

EMBL: CP000904.PE119

CP000904.PE119       Location/Qualifiers
FT   CDS_pept        complement(167086..167832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5564"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bce:BC1062 3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5564"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46543"
FT                   /db_xref="GOA:A9VUH2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH2"
FT                   /protein_id="ABY46543.1"
FT                   /translation="MIKNKTIMISGANSGIGNACIEYFLEKSFNVIALDINTNKLVDYT
FT                   KTHTSFKLVQIDLSNSNEINNLFIQLDTDTLCPDILINAAGIREITPVLELSDDLFKKV
FT                   IDVNLVAPFILSREAAKRWYKSKTKGCIVNIASVSGLMAEPERAAYVASKHALIGLTKQ
FT                   MAMEFGKQNIRVNSISPGVIRTELTEEYFSDERLVSLIKSNQSLDTWGLPQDIVSCIEY
FT                   LISDQARFVTGSNFVIDGGWTAGKNL"
     atgataaaaa ataagactat tatgatctca ggcgccaaca gtggtatagg aaatgcttgt        60
     attgaatatt ttttagaaaa atcattcaat gtaatagctc ttgatattaa tacaaataaa       120
     ttagtagact atacaaaaac acatacgtct tttaagttag tacaaataga tttaagtaac       180
     agcaatgaga ttaataatct ttttatacaa ttggatacag ataccctttg tcccgacata       240
     cttataaacg cggctggtat cagggaaata acacctgtat tagaactctc tgatgatcta       300
     tttaaaaaag taatagatgt taatttagta gcaccattta ttctttcaag ggaagctgct       360
     aagcgttggt acaagtctaa aacaaaaggt tgcatagtaa atatagcatc tgtttcagga       420
     ttaatggctg aacctgaaag agcagcttat gttgcatcaa aacatgctct aattggactt       480
     actaaacaga tggctatgga atttggtaag cagaacatac gagtgaacag tatttctccc       540
     ggtgtcatta ggacagagct tacagaagaa tattttagtg atgagcgttt ggtatccctt       600
     ataaaaagca atcaatcctt agatacgtgg ggactaccgc aggatattgt ttcgtgtatt       660
     gaatatttaa tttctgatca ggctcgcttt gttacaggtt ccaactttgt catagatggt       720
     ggttggacag ctgggaagaa tttataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page