(data stored in ACNUC9435 zone)

EMBL: CP000904.PE120

CP000904.PE120       Location/Qualifiers
FT   CDS_pept        complement(167829..168569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC1061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5565"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46544"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH3"
FT                   /protein_id="ABY46544.1"
FT                   /translation="MLTTVSNKTSSFDVEQKVHEFESNGYIQIFNDIFLQDQEDQALLT
FT                   KAQLDYYSLQNDAYGECRARAYSRYIKYAGSSDYVLDTDNGYFQSEEYNYDDGGKIRNF
FT                   NSITDEFLHNSLIEKIVRFDSEFASNTNILDTSKDLVIGLHQVRYKATRENPSFSSPIW
FT                   LHKDDEPIVFLHLMNLSNTALGGDNLIANSPREINKLISLKDPLETLVFGQKVFHAVTP
FT                   LGTECNTEALRDILLVTFSYKEPK"
     atgctaacaa cagtttctaa taagacaagc agttttgacg tagaacaaaa ggtacatgaa        60
     ttcgaatcaa atggatacat tcaaatcttt aatgatattt ttttacaaga tcaagaagat       120
     caagcattac taacgaaagc acagttagac tactacagct tacaaaacga cgcatatggc       180
     gaatgtcgcg ctagagccta ttcaagatat ataaaatacg ctggttcttc agattatgtt       240
     ctagatacag acaatggata tttccaatct gaagaatata attatgacga tggtgggaaa       300
     attagaaatt tcaacagtat aacagatgaa tttttacata attcattaat tgagaaaatt       360
     gttcgctttg atagtgaatt tgcatctaat acaaatatac ttgatacaag taaggatttg       420
     gttataggtc tacatcaagt aagatataag gcaactagag aaaatccttc ttttagctct       480
     ccaatttggc tacataagga tgatgagccg attgtctttt tacatctcat gaatttaagt       540
     aatacagctc ttggcggaga caatctgatt gcaaacagcc ctagggaaat taacaagctt       600
     attagcttga aggatcccct agaaacttta gtatttggac aaaaggtatt ccacgctgta       660
     acaccactag gaacagagtg taatacagaa gccttacgtg acattttatt agtaacgttt       720
     tcttataagg agccaaaatg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page