(data stored in ACNUC9435 zone)

EMBL: CP000904.PE121

CP000904.PE121       Location/Qualifiers
FT   CDS_pept        169599..170204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5567"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bld:BLi01487 YrkC"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5567"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46545"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH4"
FT                   /protein_id="ABY46545.1"
FT                   /translation="MYYAPFMYRYQYPYYVNVPMYNYGRQSVYWTSPNEIEYVKRFDSF
FT                   SFSNGDESILLKDYGSEPFVVNINEATKQNNTYRKALWTGTHLQVTLMSLNVGKDIGLE
FT                   IHPGVDQFLRIEQGQGIVQMGKSKDNLNLKRNVYADFAIMIPAGTWHNLTNTGNVPLKL
FT                   YSIYAPPNHPFGTVHVTKTDALTVEEGYSHGNRNTVSY"
     atgtactatg ctccttttat gtatcgatat caatatcctt attatgttaa tgtaccaatg        60
     tataactatg ggagacagtc tgtttactgg acttctccta atgagataga gtatgtaaaa       120
     agatttgatt cttttagttt ttccaatggt gatgaaagta ttttgttaaa agattatgga       180
     tcagaaccat ttgttgttaa tatcaatgag gcaacaaagc aaaacaatac gtatcgtaaa       240
     gctttatgga caggaacaca tttacaggtt accttaatga gtctcaatgt tggcaaagat       300
     atcggtttgg aaatacatcc tggtgttgat caatttttac gtattgaaca aggtcagggg       360
     attgttcaaa tgggcaagag taaagataat ttaaatctta aaagaaacgt ttatgctgat       420
     tttgcaataa tgatacctgc cggaacatgg cataatctaa ctaatacagg taatgttccg       480
     ttaaagcttt actcgatata tgctcctcca aatcatccat ttggtaccgt tcatgttact       540
     aaaacagatg cattgactgt ggaagaaggc tacagtcatg gcaataggaa tacagttagt       600
     tattaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page