(data stored in ACNUC9435 zone)

EMBL: CP000904.PE122

CP000904.PE122       Location/Qualifiers
FT   CDS_pept        complement(170766..172085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5569"
FT                   /product="aromatic amino acid permease"
FT                   /note="PFAM: aromatic amino acid permease; Amino acid
FT                   transporter transmembrane; KEGG: bat:BAS3066
FT                   serine/threonine transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5569"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46546"
FT                   /db_xref="GOA:A9VUH5"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH5"
FT                   /protein_id="ABY46546.1"
FT                   /translation="MNGNTAKKIEFQAENTAVKNEKYPDPTKWHKQDTTWALSLFGTAI
FT                   GAGVLFLPINAGSGGLLSLLLITLLAYPVMYYSHRALAKMIYASNSAEEGITGTIREYF
FT                   GNKASIIFNIVYFVSIYTIVLMYSVALTNTASSFIVHQLHMQEPPRAILSLVLVLGLIA
FT                   ILNFGQDITVKIMSMLVYPFIASLLFISISLIPQWNTSMLSFSSVSTASTGTGYLGTIW
FT                   MILPIIVFSFNHSPMISSFVMKQRATYGIEATDAKCAQIQKVCYIMTFAVVMFFVWSST
FT                   LSLTPNDLMMAKEQNLSILSYLANELNSPVITIAAPIIAFVAITKSFLGHYIGAYEVMR
FT                   DMIIKSGKTRGKDIGEKTVKTMILTFVVLTCWYVAYANPSILGIIDALSGPLVAAILCL
FT                   LPMYAIRKVPVLAKYRGKMSNVFVIIIGILTVLASIKSLF"
     atgaatggga atactgcaaa aaaaatagaa tttcaggctg aaaatactgc agtaaaaaat        60
     gagaaatatc cagatcctac aaagtggcat aaacaggata ctacctgggc attgagcctt       120
     tttggaacag ccattggagc aggagtactc tttttaccga ttaatgcagg ttcagggggg       180
     ttattatcat tactactaat tacattactt gcatatccag ttatgtatta ctcacatagg       240
     gcgcttgcta aaatgatata tgcttccaat tctgctgaag aggggattac aggtacaata       300
     agagagtatt ttggaaataa ggcaagtatc atttttaaca tagtatattt cgtctcaatt       360
     tatacaatcg tgctaatgta ttctgttgca cttacaaata ctgcaagtag ttttatcgtg       420
     catcaattgc acatgcagga gcctccaagg gccattttat cgcttgtatt agtactcggt       480
     cttatcgcta tactaaattt tggtcaagat atcactgtaa agataatgag catgcttgta       540
     tatcctttca tagcttctct actttttatc tcaatatctt tgattccaca gtggaatacg       600
     tcaatgctta gtttttcaag tgtttctact gcttcaacag gaacaggata tttgggaacg       660
     atatggatga tactaccaat catagtattc tcgtttaatc attctcctat gatttcgtca       720
     tttgttatga aacagagagc tacgtatgga atagaagcta ctgatgccaa atgtgctcaa       780
     atacaaaaag tttgttatat catgacattc gctgttgtta tgttctttgt ttggagcagt       840
     accttgagtt tgactccaaa tgatcttatg atggcaaaag aacagaattt gtcaatccta       900
     tcatatcttg ctaatgagct taattcgcct gtaatcacga ttgcagctcc tatcattgct       960
     tttgtggcta ttacaaagtc tttccttggc cattatatag gagcatatga agtaatgcgt      1020
     gacatgatta ttaagtccgg taaaacacgc gggaaagata taggagaaaa aacagttaag      1080
     acaatgatcc ttacttttgt cgtattaaca tgctggtatg ttgcttatgc aaatccaagt      1140
     attcttggaa tcattgatgc ccttagcgga ccgttagttg ctgctatctt atgtttatta      1200
     ccaatgtatg caattcgtaa agtgcctgta ctagctaaat atagagggaa aatgagcaat      1260
     gtatttgtca ttattatagg tatccttacc gtcctagcaa gtattaagtc attattctaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page