(data stored in ACNUC9435 zone)

EMBL: CP000904.PE123

CP000904.PE123       Location/Qualifiers
FT   CDS_pept        complement(172383..173270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5570"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: bat:BAS3067 L-serine dehydratase,
FT                   iron-sulfur-dependent, alpha subunit; TIGRFAM: L-serine
FT                   dehydratase, iron-sulfur-dependent, alpha subunit; PFAM:
FT                   serine dehydratase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5570"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46547"
FT                   /db_xref="GOA:A9VUH6"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH6"
FT                   /protein_id="ABY46547.1"
FT                   /translation="MYMTIREIVDAANKSQKPIYELAIEQEIEQTKTSYEEAWSKMERN
FT                   LATMENAINKSIEGDGVFSPTGLTGGDAVKIKYYRENRKTLSGDLMVLGIQSAIGVNEV
FT                   NAALGAICATPTAGASGTIPGVLYSIKDTMQLTHEDMIHFLFTSALLGTIVANNACISG
FT                   AYGGCQAEVGSASAMAAAAAVEVAGGTPQQSSEAFSTALQNLLGLVCDPVAGLVEIPCV
FT                   KRNAIGTANALAAADIALAGVNNIINADEVIEAMYRVGRQMPRELRETGLGGIAATPTG
FT                   IAIKNKIFGEKQSN"
     atgtatatga ctataagaga aattgtggat gcagctaata aaagccaaaa gccaatttat        60
     gaattagcaa tcgaacagga aatcgaacaa actaaaactt cttatgaaga agcttggagt       120
     aaaatggaaa gaaatttagc gactatggaa aatgccataa ataaaagtat cgagggcgac       180
     ggggtatttt ctccgaccgg tttaaccgga ggtgatgctg ttaaaattaa atactatcga       240
     gaaaatagga aaactctttc tggagatttg atggtgttag ggattcaaag tgctatcggt       300
     gttaatgaag taaatgctgc attaggggct atttgtgcaa ccccaacagc aggtgcgagt       360
     gggacgatcc cgggagtcct atatagtatt aaagatacga tgcagttaac tcatgaagat       420
     atgatccatt ttctattcac ttcagcgtta cttggaacga tagtcgcaaa taacgcttgt       480
     atttcaggag cgtacggagg atgtcaagct gaagtaggca gtgcctcagc aatggcggct       540
     gcagcagcgg tagaagttgc cggaggaacg ccacagcaat cttctgaagc tttctcaacc       600
     gcattacaaa atttactcgg tctagtttgt gatccggtcg ctggtttggt agaaattcct       660
     tgtgtaaaga gaaacgccat tggaacggca aatgctttgg cagcagcaga catcgcatta       720
     gccggcgtaa acaatatcat caatgcagac gaagttattg aagcgatgta tagagttgga       780
     agacagatgc ctcgcgaatt aagagagaca ggtttaggcg gaattgcggc cacacctaca       840
     gggattgcca ttaaaaataa aatctttggg gagaaacaat caaattaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page