(data stored in ACNUC9435 zone)

EMBL: CP000904.PE124

CP000904.PE124       Location/Qualifiers
FT   CDS_pept        complement(173293..173991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5571"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /note="TIGRFAM: L-serine dehydratase,
FT                   iron-sulfur-dependent, beta subunit; PFAM: serine
FT                   dehydratase beta chain; KEGG: bat:BAS3068 L-serine
FT                   dehydratase, iron-sulfur-dependent, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5571"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46548"
FT                   /db_xref="GOA:A9VUH7"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH7"
FT                   /protein_id="ABY46548.1"
FT                   /translation="MNMNVASIKEKKVVKYKSCFDVIGPVMIGPSSSHTAGALAIGTVA
FT                   NKLFQGLPKKVVVRYYESFAETHKGHGTDFAIIAGILGFAADDSKVPDAIKIAESKGID
FT                   ITFIEKAGDSPAGHPNTADVYLEDESRSIRTMGISVGGGLIEVKHVEIDGFSLDLQGPL
FT                   PVIIAISERADFEFVLRRVFKQYDVEINNFHSLEENRKYLYAFALDSLLPGYVQKELGN
FT                   LSNIANVIIL"
     atgaacatga atgtagcatc tattaaagaa aaaaaggttg ttaaatacaa aagttgtttt        60
     gatgtgattg ggccggtaat gataggtcct tcaagttcac atactgcagg tgctttggct       120
     attgggacag ttgccaataa attatttcaa ggtcttccaa aaaaagtcgt ggtaaggtat       180
     tatgaatcat ttgctgaaac ccataaagga cacggaactg attttgcaat tattgctggg       240
     atattaggat ttgctgccga tgacagcaaa gtgccagatg ctattaaaat agcagaatct       300
     aaaggaattg acattacctt tattgaaaaa gcgggtgata gtcctgctgg tcatcccaat       360
     acggcagatg tatatttaga ggatgaaagc cgaagtatta gaacgatggg tatttcggtc       420
     ggcggtggat taattgaagt caaacatgtt gaaattgacg gatttagctt agatctgcag       480
     gggccattgc cagttattat tgcgatttct gaaagagctg actttgaatt tgtcttacgc       540
     agggtcttta aacaatatga tgtggaaatt aacaactttc atagtttaga agaaaacaga       600
     aaatatttat atgcattcgc tttggattcg ctattgcctg gttatgttca gaaggaattg       660
     ggaaatttaa gcaatatagc taatgtcatt attctttag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page