(data stored in ACNUC9435 zone)

EMBL: CP000904.PE125

CP000904.PE125       Location/Qualifiers
FT   CDS_pept        complement(174910..175134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5572"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46549"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH8"
FT                   /protein_id="ABY46549.1"
FT                   /translation="MEYKIKVTIGNYVQFSYRKNSNLQLMGYVVSVLQNTIVVDISEIM
FT                   GIEVDDVRQVVKHGCYNKVVHKQIKNTVS"
     atggagtata aaataaaggt aaccattggg aattacgttc aattttcata tcgtaaaaat        60
     tctaatttgc aattaatggg atatgtagtg agtgttctac agaatacaat tgttgtagat       120
     atttcagaga taatgggaat agaagtagat gatgttaggc aagtagtaaa acatggttgc       180
     tataataaag tggttcataa gcaaataaaa aatactgttt cataa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page