(data stored in ACNUC9435 zone)

EMBL: CP000904.PE126

CP000904.PE126       Location/Qualifiers
FT   CDS_pept        175365..176912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5573"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   bat:BAS3369 spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5573"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46550"
FT                   /db_xref="GOA:A9VUH9"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH9"
FT                   /protein_id="ABY46550.1"
FT                   /translation="MAKFLKRLKYRDNPKSFSIRDNTHFQKKNIEDSLLGADLSKNIAD
FT                   IQNIFRQAPDLVIRRFQIKADGLEAGLVYLSGLTDKELIQNHVLSPLMNSDFDTNTELP
FT                   IPLGQIKIINTWSQIENAIFGGDSVLLIHTRTTAHQLDTKGWPQRNVEDAHNEIALKGA
FT                   HQGFTEIRSQNIAMIRRYIPHRELTVKEIVIGVRSKTRISILYLKDVASEDVLKELETR
FT                   IHNITVDAVASNGELIEFIEDNPYSPFPQFILTERPDLAVSHILQGRFVTVMDHSPNVL
FT                   IAPTNFISFFQGVDDYGTRWLVASSIRMLRFISFIIALFLPASYVAFISFNFEVIPVEL
FT                   YLSIAESRTRVPFSPVMEALLMEITLETMREGALRIPTPIGQTVGVVGGIVIGQAAVQA
FT                   GIVSNIMIIVVAITAISSFVIPNYDMGAAVRLLRFPMMLAAALFGIVGLVIGWMTLIGH
FT                   LISLESLGTPYGTPLAPFRFADMKDAFLRFPLWAIRRRPKGNGTIQSIRQGKNPNKR"
     atggctaaat ttttgaagcg tttaaaatat agagacaatc ctaagtcatt ttcaatacga        60
     gacaatactc attttcagaa aaaaaatatt gaagactccc tcttaggcgc tgatttatcg       120
     aaaaacatag ctgatattca gaatatattt cgtcaagcac ctgatttagt gattcgccgg       180
     tttcaaataa aagcagatgg attagaagct ggtttagtat atttgtctgg attaacagat       240
     aaagaattga ttcaaaatca tgttctaagt cctttgatga atagtgattt tgataccaat       300
     acggaacttc caattccatt aggacaaatc aaaattatta atacgtggag tcagattgaa       360
     aatgctattt ttggaggaga tagtgtttta ttaatccaca ctcgaacaac agcacatcaa       420
     ttggatacga aaggatggcc acaaagaaat gttgaagacg ctcataacga aatagctcta       480
     aaaggtgcgc atcaaggatt tacagaaatt agaagtcaaa atatcgcaat gattcgaagg       540
     tatattcctc atcgtgaatt aacggtaaaa gaaatagtaa ttggtgtacg aagcaaaacg       600
     aggatttcta ttttatattt gaaagatgta gcttctgaag atgtgctgaa ggaattagaa       660
     acacggattc ataatattac agtcgacgct gttgctagta atggggaact tatagaattc       720
     attgaagata acccgtactc accgtttcca caatttatat taactgaaag acctgatttg       780
     gcagtatctc acattctaca gggcagattt gtaactgtaa tggatcattc gcctaatgtg       840
     ttaattgctc caacaaattt tatttccttt tttcaaggag tggatgatta cggtacaagg       900
     tggttagttg cttcgtctat tcggatgctt cgttttatct cctttataat tgctttattt       960
     ttgcctgcga gttatgttgc gtttatttcc tttaattttg aagttattcc agtagagctg      1020
     tatttatcta ttgcagaatc aagaacgcgc gtaccctttt ctccagttat ggaagcatta      1080
     cttatggaaa taacattgga aacgatgaga gaaggggctt tacggatacc tactccgatc      1140
     ggtcagacag ttggagttgt aggtggtatt gtcattggac aggcggctgt tcaggcggga      1200
     attgtaagca acattatgat tattgttgtt gctattacag ccatctcttc ttttgttatc      1260
     cctaattatg atatgggagc ggcagtaaga cttttacgct ttccgatgat gctagcagct      1320
     gccttatttg gaattgttgg acttgttatc gggtggatga ctttaattgg acatctaatc      1380
     agtcttgaat cgctaggtac tccttacgga acgccattag caccgtttcg ctttgcagat      1440
     atgaaagatg cttttttacg ctttccttta tgggcaataa gaaggcgtcc taagggtaat      1500
     ggaaccattc aatctattcg acaaggaaag aatcctaata aaaggtga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page