(data stored in ACNUC9435 zone)

EMBL: CP000904.PE127

CP000904.PE127       Location/Qualifiers
FT   CDS_pept        176917..178020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5574"
FT                   /product="spore germination protein"
FT                   /note="TIGRFAM: spore germination protein; PFAM: Spore
FT                   germination protein; KEGG: btk:BT9727_3333 spore
FT                   germination protein; amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5574"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46551"
FT                   /db_xref="GOA:A9VUI0"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI0"
FT                   /protein_id="ABY46551.1"
FT                   /translation="MKKYAYNDITLMQYIVLINGMQVATGVLSLPRVLAENAGTDGWIA
FT                   ILIGWIFSTISGVFIVKTAARYPEDTIYDILIRLFGKIVGKAFVVIYMMYFAFYTCIVL
FT                   VNAMLFLKGWLLPKTPDYIVIFLFSIPTFFVARNGPRIIGRYSELFLYMALWIPLFFLI
FT                   PLKENGSWMPFFPLLKEGWKPVLTAVPTTIFAYLGFDIAFFLYPFLQKKQYAVHGMVIA
FT                   NTLTMLFYLFTTIVCFAYFSPDSITQYNQPVLNLVKVIEFRFLERFDMILLAVYLTIVS
FT                   TSWIPALYCSVFCSSQLLGKQDHSSHVVVLLLLIIGIIFWTHPSWNEAEIWQQVFSNAG
FT                   LGLTYILPIILWLYCCLYEKFRQGRIH"
     atgaaaaagt atgcctataa tgacatcact cttatgcagt atattgtttt aatcaatgga        60
     atgcaggtgg ccactggcgt tttatcactt ccgcgcgtgc ttgcagaaaa cgctggaaca       120
     gatggatgga tagctatatt gattggttgg atattctcca caatatcagg tgtttttatc       180
     gtgaaaactg ctgcaagata tcccgaggac acgatttatg acattcttat acgattgttt       240
     ggaaaaatag tagggaaagc attcgttgtt atttacatga tgtacttcgc tttttatact       300
     tgtatcgttc ttgtaaacgc tatgcttttt cttaagggat ggcttcttcc gaaaacgcct       360
     gactatatcg ttatcttttt gttttcgatt cctacctttt ttgttgcgcg taacggacct       420
     cgtattatag ggcgatactc cgaacttttt ttatatatgg cgctttggat tccgttgttt       480
     tttttgatac cgcttaaaga gaacggaagt tggatgccct tctttccgct attaaaagaa       540
     ggatggaaac ctgtattaac ggccgtaccg accactattt ttgcttattt agggtttgat       600
     attgctttct ttttatatcc ttttttacaa aaaaaacagt atgcagtcca tggaatggtt       660
     attgcaaaca cattaacgat gttattttat ttatttacta ctattgtttg ttttgcttat       720
     tttagccctg atagcattac gcaatataat caaccggtac taaatttagt gaaagtaatt       780
     gaatttcgtt ttttagaacg ttttgacatg attttattgg ctgtttactt aaccattgtt       840
     tccacatcat ggattcctgc cttatactgt tctgtatttt gttcaagcca attacttgga       900
     aaacaagatc atagctctca tgtagttgtt ctcttattgc tcattatcgg catcatattt       960
     tggactcatc ctagttggaa tgaagccgaa atttggcaac aggtattttc gaatgctgga      1020
     ttaggattaa cctatatatt acctatcatt ttatggctgt actgctgtct atatgagaag      1080
     tttcgacagg ggaggataca ttga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page