(data stored in ACNUC9435 zone)

EMBL: CP000904.PE128

CP000904.PE128       Location/Qualifiers
FT   CDS_pept        178062..179120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5575"
FT                   /product="spore germination B3 GerAC family protein"
FT                   /note="PFAM: spore germination B3 GerAC family protein;
FT                   KEGG: btl:BALH_3215 spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5575"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46552"
FT                   /db_xref="GOA:A9VUI1"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI1"
FT                   /protein_id="ABY46552.1"
FT                   /translation="MTGCFDQTNVEDVSLTLVLGIDLDRNDNLLVYISSPVFNKEAKIK
FT                   EETTGVKSATVRKSRDQFDATVMALTAGSKTQVILVGKRLLKRKNWENHLDPFYRDPKN
FT                   TVTARVVAVDGPVSDVIFYSPKDKPRLPIYLTKLVDTASLRNITVKTTLQELYEQRADK
FT                   GVTANITEVKKKNKIWVTGTALLDEKGKYKLTLKSDETKLLRILQQRTTGEFPFTIPIK
FT                   LKSDSQDKDWISFTANGIKVKTKARYDNHFIFNVDVKMRIGITERLFSFNTKKDAAKLQ
FT                   KAIETKLEADFKQLIQKMQTSKIDPIGLGGYARTYTYPEWKKVQNKWNNELAKGDVNVK
FT                   VKIKIGGMGTIK"
     atgactggat gctttgatca aacaaatgtt gaagatgttt ctcttactct tgttcttggt        60
     attgatttag atcgtaatga taatttatta gtgtatatat ctagccctgt tttcaataaa       120
     gaagcaaaga taaaagaaga aactactggt gtgaaatctg ctacggttcg aaaatctaga       180
     gaccaatttg atgctacggt tatggcgctt accgcgggaa gtaaaacaca ggttatttta       240
     gttggaaaaa ggctactgaa acgaaaaaac tgggaaaatc acctcgatcc attttaccga       300
     gatcccaaaa atacagttac cgcaagggtt gtcgctgtag atggacctgt ttcggacgtc       360
     atcttctata gcccaaaaga taagcctcgg cttcctatat atttaacaaa actagttgat       420
     accgcttctt taagaaatat cacagtaaaa acaactcttc aagaactata tgaacaaaga       480
     gcagacaaag gggtaacagc aaatattact gaggtgaaaa aaaagaataa aatatgggtg       540
     acaggtacag ctttattgga tgaaaaagga aagtataaat taacgctaaa atctgatgaa       600
     accaaactat tacgcatttt gcaacaaaga actacaggtg agtttccatt cacaattcca       660
     attaagctaa agtcggatag ccaagataaa gattggataa gttttactgc caatggtatt       720
     aaagtaaaga caaaggcaag atatgataat cattttatat ttaatgtaga tgtaaagatg       780
     agaatcggta ttacagaacg gcttttttcg tttaatacaa aaaaggacgc agcaaaatta       840
     caaaaagcga ttgaaactaa gctggaagct gatttcaagc aattaataca aaaaatgcaa       900
     acttccaaaa tcgaccctat tgggcttgga ggatatgcaa gaacttacac atatccagaa       960
     tggaaaaaag tccaaaataa atggaataat gaattagcaa agggcgatgt aaacgtcaag      1020
     gttaagatta aaattggcgg gatgggaacg attaagtaa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page