(data stored in ACNUC9435 zone)

EMBL: CP000904.PE129

CP000904.PE129       Location/Qualifiers
FT   CDS_pept        complement(179454..180269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btl:BALH_2453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5576"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46553"
FT                   /db_xref="GOA:A9VUI2"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI2"
FT                   /protein_id="ABY46553.1"
FT                   /translation="MSFSNELKKAMKQEVPKEVKERAYQSFTQIHKRENKNKLKKKLLI
FT                   TGVAAAIIIPTSTMALNNSYFTQPQLKLNDMITDQVRKYAAAGKSIPLDQKITDQGITL
FT                   HLKEMLLQEDKILVYYRFEQQDGSLIPYEFNTNGLHIVSSGKEKGKQVARPTYKNEKFN
FT                   TVSELGFLSNNNLDSYQKDRIGNPNAPDIGMFYLTNATGKAFETALAFHDKPEGTVVFE
FT                   VLQGERFPNSLTINININRVGKTEGNWITKILIDVEHKSVQKTDMDKNQ"
     atgtcatttt caaatgaatt aaaaaaagca atgaaacaag aagttcctaa agaagtaaaa        60
     gaacgtgcat atcaatcatt tacgcaaatt cacaaaaggg agaacaaaaa taaattgaaa       120
     aagaaattat taataacagg tgtagcagca gctatcatta taccaactag cacaatggca       180
     ctaaataact cttattttac gcaacctcaa ttaaaattga atgacatgat tactgatcaa       240
     gttagaaagt atgcagcagc gggaaaatct atacctttgg atcaaaaaat aacagatcaa       300
     ggaattacgc ttcatttaaa agaaatgtta ctccaagagg ataaaatact tgtttactac       360
     cgttttgaac aacaagatgg atcattaatt ccgtatgaat ttaatacaaa tggattgcat       420
     atcgtatcca gtggtaaaga aaagggtaag caagtggcaa ggccaacata taaaaatgaa       480
     aaatttaata ctgtaagtga attgggtttt cttagtaaca ataatctaga cagctatcaa       540
     aaggatcgta ttggtaatcc aaatgcaccg gatataggta tgttttactt aactaatgca       600
     acaggaaagg cttttgaaac tgcactggct tttcatgata aaccagaagg aacagtagtt       660
     tttgaagtac ttcaaggaga aagattccct aattctttaa ctataaacat aaatattaat       720
     agagttggaa aaacagaagg aaattggata accaaaattt taattgatgt agagcataaa       780
     tccgtacaaa agactgatat ggataaaaat cagtag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page