(data stored in ACNUC9435 zone)

EMBL: CP000904.PE13

CP000904.PE13        Location/Qualifiers
FT   CDS_pept        31461..31853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5445"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46437"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV05"
FT                   /protein_id="ABY46437.1"
FT                   /translation="MEVFFCMTQVRIRSITKDEKSPWVYIQEETRQETPKANVFQVKAE
FT                   PVIRRNTKTNQYGRFRYSEMQYGRIEAILASALEISKSPMRIRNQNGEWVYIQQTTIDG
FT                   ACPAIRIRNRYSEQAGPWVYIQHKEV"
     ttggaggtgt ttttctgtat gacacaggta cgaattcgtt ccattacaaa agacgaaaaa        60
     tctccctggg tttatattca agaagagacc agacaggaaa ctccaaaagc aaatgtattc       120
     caagtaaaag ccgaacctgt tataagacga aacaccaaga caaatcaata tggccgtttt       180
     cgttacagtg aaatgcaata tggaagaatt gaagcaatct tagcttctgc tttagagata       240
     agtaaatctc ctatgagaat aagaaaccaa aacggagaat gggtctatat ccaacaaaca       300
     accatcgatg gcgcttgtcc tgctattcgg atacgaaatc gatatagtga acaggcaggt       360
     ccttgggttt atatccaaca taaggaggtc tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page