(data stored in ACNUC9435 zone)

EMBL: CP000904.PE130

CP000904.PE130       Location/Qualifiers
FT   CDS_pept        complement(180253..180837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5577"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: bat:BAS2758 RNA polymerase
FT                   sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5577"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46554"
FT                   /db_xref="GOA:A9VUI3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI3"
FT                   /protein_id="ABY46554.1"
FT                   /translation="MATNDNISTWIDRLLSGDEEAFEYIFDLTNQRIYDTVFAIVKNGH
FT                   DTNEIVNEVYFQLWKSISKYDQSRPFLFWLNGIVYKQISQWRKQVWKRMRLFEKQHSMQ
FT                   ESVVEIPEKLLLEKETQKELLTLIQELPFKFRVVIVYRFYHDYTYEEIAELLQIPIGTV
FT                   RSRIHRALEKIRNQSNIEIDEEEYNSNVIFK"
     ttggccacta atgacaacat aagcacctgg atagaccgtc tgttatcagg tgacgaagaa        60
     gcttttgaat atatatttga tttaacaaat cagagaatat atgacaccgt atttgctata       120
     gttaaaaatg gtcatgatac aaatgaaatt gtaaatgagg tttattttca actatggaaa       180
     tccatctcaa aatatgatca atctagacct tttttatttt ggttgaatgg cattgtctat       240
     aaacaaatta gtcaatggcg aaaacaagtt tggaagagga tgcgtttatt tgaaaaacag       300
     cattcaatgc aggagtcagt tgtagaaatc ccagaaaaat tattacttga aaaggaaaca       360
     caaaaggaat tgttaacatt gattcaagaa ttgccgttca aatttagagt tgtgatagtg       420
     tatcgttttt atcacgatta tacgtatgaa gaaattgcgg aattattaca aatccctata       480
     ggtacggtaa gatctagaat tcatagagcg ttagaaaaaa ttcggaatca atctaatata       540
     gaaatagatg aggaggaata taattcaaat gtcattttca aatga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page