(data stored in ACNUC9435 zone)

EMBL: CP000904.PE131

CP000904.PE131       Location/Qualifiers
FT   CDS_pept        complement(181083..181406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5578"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46555"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI4"
FT                   /protein_id="ABY46555.1"
FT                   /translation="MDIKYDEYELLELFESEPEDFLIEGAGVYLYRKMDHLGFKLITIM
FT                   SVYENTIKLSLSYNEGCVFDVNMEFVERVYTRNDILHIQCSEEKKAIEVRFKPHFAINI
FT                   REF"
     ttggatatta aatatgatga atacgaacta ttagagctat tcgagagtga accagaagac        60
     tttttgattg aaggtgcagg tgtgtatctt tatcgtaaaa tggatcactt aggatttaaa       120
     ttaataacga ttatgtcagt ttatgagaat acaattaaat taagtctttc ttataatgaa       180
     ggatgtgtat ttgacgttaa tatggaattt gtagaacgag tctatactcg caatgatata       240
     ctccatatcc agtgctctga agagaaaaaa gcaattgaag taagattcaa accacatttt       300
     gcaattaata ttagagaatt ctaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page