(data stored in ACNUC9435 zone)

EMBL: CP000904.PE132

CP000904.PE132       Location/Qualifiers
FT   CDS_pept        complement(181446..181727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5579"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46556"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI5"
FT                   /protein_id="ABY46556.1"
FT                   /translation="MAPDTLGIRAELNSRAKEMAAKKGYKLGSAEYNELFSKIDPRGMT
FT                   PNVVEDIIKTGSRAPADTPGTWKYSRADGYVILNDNGDVITAVPAKKK"
     atggctccag atacccttgg aataagagcg gagcttaatt caagagctaa ggaaatggct        60
     gctaaaaagg gatataaact aggttctgcg gaatataacg agctattttc taaaattgac       120
     cctcgtggta tgacacctaa tgtagttgaa gatattatca aaacgggttc tcgtgctcca       180
     gctgatacgc ctggcacatg gaaatatagt agagcagatg gttatgttat acttaatgat       240
     aacggggacg ttattaccgc tgttcccgca aagaaaaaat aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page