(data stored in ACNUC9435 zone)

EMBL: CP000904.PE134

CP000904.PE134       Location/Qualifiers
FT   CDS_pept        complement(182568..183164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5582"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dps:DP2317
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5582"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46558"
FT                   /db_xref="GOA:A9VUI7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI7"
FT                   /protein_id="ABY46558.1"
FT                   /translation="MNTNKVEKTKAYIIKKTLPIFNKKGYYGTSLSDITNATKLTKGSI
FT                   YGNFKDKDDVAVNCFLFNVNNITDEIYNNMQGAKNSLEKLLVFPKIYRKIFKDIIANGG
FT                   CPIANTLIESDDTHPILLKLALDTLYRLENFLVSIIEEGLLYGEFIETTESHKTVQTII
FT                   TLCEGGMILTKSTKKESYLINAIETIEEIIYSLKK"
     atgaatacaa acaaagtcga aaaaacaaaa gcctatataa taaaaaaaac attacccata        60
     tttaataaga aggggtatta cggaacatct ttatcggaca taaccaatgc gacgaagctt       120
     acaaaaggta gtatatacgg taattttaaa gataaagatg atgttgcggt gaactgcttt       180
     ttattcaatg tcaacaatat aacagacgag atttataaca acatgcaagg agctaaaaat       240
     tcattagaga aactgttggt ttttccgaaa atttatagaa agatttttaa agatattatt       300
     gctaatggtg gttgtccgat tgcaaatact cttatagaat ctgatgatac acatcctata       360
     ttgttaaagc tcgcattaga tacattgtat cgtttggaaa atttcttggt ttctataatc       420
     gaagaaggac tattgtatgg ggaatttatt gaaaccacag aatcacataa aacagtacaa       480
     actattataa ctttatgtga aggtggaatg attttaacaa aatcaacaaa aaaagagagc       540
     tatttaataa atgcaattga aacaattgaa gaaattatat actctctgaa aaagtaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page