(data stored in ACNUC9435 zone)

EMBL: CP000904.PE135

CP000904.PE135       Location/Qualifiers
FT   CDS_pept        complement(183515..183826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5583"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   btl:BALH_4674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5583"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46559"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI8"
FT                   /protein_id="ABY46559.1"
FT                   /translation="MIVTTTNTIQGKEIIEYVDIVNGEAIMGANIVRDIFASVRDVVGG
FT                   RSGAYESKLKEARDIAMEEMKQLATQKGANAIVGIDVDYEVVRDGMLMVAVSGTAVRV"
     atgatcgtaa caacaactaa tactattcag ggtaaagaaa ttattgagta tgtggacatc        60
     gtaaacggtg aagcaattat gggtgcaaat atcgtacgcg acatcttcgc ttctgttcgt       120
     gatgttgtag gtggccgttc tggtgcttat gaaagtaaat taaaagaagc tcgtgacatt       180
     gcgatggaag aaatgaaaca acttgcaacg caaaaaggag caaatgcaat tgttggtatc       240
     gatgtagact acgaagtggt tcgtgacgga atgttaatgg ttgcggtaag cggtacggct       300
     gtacgtgtgt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page