(data stored in ACNUC9435 zone)

EMBL: CP000904.PE136

CP000904.PE136       Location/Qualifiers
FT   CDS_pept        complement(184041..186254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5584"
FT                   /product="putative cell wall binding repeat-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat-containing
FT                   protein; KEGG: cpf:CPF_0490 cell wall binding repeat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5584"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46560"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI9"
FT                   /protein_id="ABY46560.1"
FT                   /translation="MKKKFKTIGIGKKVIPTAAALGILFSVAPIAENKASAGIGTVIDI
FT                   SITVLGAVANTYEALGINPENPDPGTHIDVYAENETYQAPSFTSGEFNISMYHTQGDVN
FT                   FLKPVKVRYPNGRIEIHQLKSGQQLKITEAGAIIDLNPNGANVSEHDLLYITQAQLDEG
FT                   KTGVVINQGQHAFVEKASGKNPRFLGPLYKKYSGDSFGDWTVIARNSDYLFDQIANKLS
FT                   DKQKQLITLTSKPVSKDVLDTYVNNEPKARADFYDRLSDILAERTNVLETSIALPFTTL
FT                   NDGKSYQIIPYKKGTNKVIVKTGSKYLSGKEGNRLQYSDSLGDDEVFELVQIGNSYDDK
FT                   FQFRLNNKNGVSLAGNQNIHGFATDWSFKSEIRFPDKSNNEIHNWLIEWYPGKENERQK
FT                   YDKIEMIKNEKDPTKYSAKDSSGNVIKNSWVNRENQYFFADAEGVILTGWQEIKGKTYY
FT                   FSSPYGQMVTGGGSDSLIDGKFYNFNDSGVLQRSVWRGNNYSDASGEFVKEGLKDIDGK
FT                   VYYFKDYHPTTNELPIKDQDVTLHFSDKGVIERVSKLNGEAINSSVNVKLDNKTLAFNQ
FT                   DGSILKTGINKNANTIAYYSLEDGPSYTGWKMIDGKRYYFTNGFNDTFNDYKNIDGKKY
FT                   YFHEDGSVNRAGFEKTDGKLYHFDNNGVAQTGWQTIDNKYYYFDENGAAKTGWFQVGGG
FT                   YRPWPLAYGYLWYCAREDGSLYSDGWFKIDGKDYHFDQWGHKM"
     atgaagaaaa aatttaaaac aattggaatt ggaaagaaag taattcctac tgcagcggca        60
     ttaggtattc ttttttcagt agctcctatt gcagaaaata aggctagtgc agggataggt       120
     acggtaatag atatatctat tactgtatta ggggctgtag caaacactta tgaagcactt       180
     ggaataaacc cagagaatcc agacccaggc actcacattg atgtatatgc agaaaacgaa       240
     acttaccagg ctcctagttt tacatctggg gaatttaata tttccatgta tcatacacaa       300
     ggtgatgtga attttcttaa accagttaaa gtacgctatc caaatggaag aattgaaatt       360
     catcaactaa aatctgggca gcagcttaaa attactgaag caggtgcaat tatagatcta       420
     aaccctaatg gagcaaatgt ctcagaacac gatcttcttt acattacaca agcacaatta       480
     gacgaaggaa agaccggagt tgtgataaat caaggccaac atgcatttgt agaaaaagca       540
     tctggtaaaa acccaagatt tcttggtcca ctttacaaaa aatattccgg cgactccttt       600
     ggcgattgga cggtgattgc tagaaattcg gattacctat ttgatcagat agcaaataaa       660
     ttatcagata agcagaaaca attgataaca ttgacttcaa agccagtatc caaagatgtt       720
     cttgacacct atgttaataa tgagcctaaa gctcgtgcag atttttatga tcgattatct       780
     gatatattgg cggagcgtac taacgtccta gagacatcta ttgcactacc atttactaca       840
     ctaaatgatg gtaaatctta tcaaattatc ccttataaaa aaggaacgaa taaagtaatc       900
     gtaaaaacag gttcaaaata cctttcagga aaagaaggaa acagacttca atattccgat       960
     tcgcttggcg atgatgaagt gtttgaactt gttcagatag gaaattctta cgatgataaa      1020
     tttcagttcc gtttgaataa caaaaatggg gtaagtttag ctggtaatca aaacattcat      1080
     ggattcgcta ctgattggag tttcaaatct gaaattcgtt tccctgataa aagcaacaat      1140
     gaaattcaca attggttaat agaatggtat ccgggtaaag aaaatgagag acagaagtat      1200
     gacaaaatag agatgataaa gaatgaaaag gaccctacta aatatagtgc aaaagattcc      1260
     tctggaaacg tgataaagaa cagctgggta aatcgagaga atcagtattt ctttgcagat      1320
     gctgaaggag tcattttgac aggctggcaa gaaattaagg ggaagactta ttatttctca      1380
     tcgccttatg gccaaatggt tactggaggt ggaagtgatt cactgattga tgggaagttc      1440
     tataacttca acgactccgg tgttctgcaa cgatcagtct ggagaggtaa taactattcc      1500
     gatgcttcag gagaatttgt taaagaaggc ttgaaagata tagacggtaa agtttattat      1560
     tttaaagatt atcatcctac tacaaatgaa ctacctataa aagatcaaga tgtcactctt      1620
     cacttttccg acaaaggtgt gattgagaga gtttctaagc taaatggaga agctataaac      1680
     agcagtgtta atgttaagct tgacaacaaa acattagcat ttaatcaaga cggttcgatt      1740
     ttgaaaacag gaatcaacaa aaatgcgaat acaatagcat attatagttt agaggatggg      1800
     ccttcctata ccggttggaa aatgatagac ggtaaaagat actatttcac aaatggcttc      1860
     aatgatacgt tcaatgatta taaaaacatt gacggaaaaa aatattattt tcatgaagac      1920
     ggatcagtta accgcgcagg atttgaaaaa acagatggta aactatacca ttttgacaat      1980
     aacggcgtag cacaaacggg ctggcaaact atcgataata aatattatta cttcgatgag      2040
     aatggagcag ctaaaacagg atggttccaa gttggtggtg gatatagacc ttggcctctt      2100
     gcatacggat acctttggta ttgtgctaga gaagatggtt cactttattc agacggttgg      2160
     tttaaaatcg acggtaaaga ttatcacttt gaccagtggg gacataaaat gtaa            2214
//

If you have problems or comments...

PBIL Back to PBIL home page