(data stored in ACNUC9435 zone)

EMBL: CP000904.PE137

CP000904.PE137       Location/Qualifiers
FT   CDS_pept        186850..188049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5585"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46561"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ0"
FT                   /protein_id="ABY46561.1"
FT                   /translation="MKGKIKRCIKKIPPVGIAMGIVFSLNPFTKHKAKADVDTFATIVT
FT                   TFGDTYDSFLKEPFVISLSEQSAKNDYLANNENRAYKAPTFNKGEFGISAYDYYKNQNF
FT                   SKRIKLFYKDGKVEYKTIKHGQQLLIKQAGIIVDLNPDASDLYEHDILYITQKQLDEGN
FT                   TGIALTNWQTYYLKSDNSGQMNGPLALKYIRQEFPNIKPGSASFDLEKLFHALPEEKRK
FT                   LATITSNPVKPSEIFSYTSDELAEIKRHKLAVVTQYKNEECSSISMKIRNRDNVLRTWE
FT                   DSMNISASSNWIPEDRSIFTIIPIKKGSNKVYIEANSTYLTSANGEVGVTGFRAYGQVW
FT                   TLVNYGFESFSLKNNHGQYLSVNDTSVCLTDKPDKNTIFPITIQKEKWNEWLAKWYSSK
FT                   "
     atgaagggaa agataaagag atgtataaaa aaaatccccc ctgtaggaat agcgatgggg        60
     attgtattca gcttgaaccc atttacaaaa cataaagcaa aagcagacgt tgatacgttc       120
     gcaacgattg ttacaacatt tggtgatacc tatgattcgt ttttaaaaga gccttttgtt       180
     atttctttat cagaacaaag tgctaaaaat gattatctag ctaacaatga aaaccgtgct       240
     tacaaagctc ctacttttaa caaaggagaa tttggtatta gtgcgtatga ttattataaa       300
     aaccaaaact tttctaagag aattaaactt ttctataaag atgggaaagt tgaatataaa       360
     acgataaaac atggtcaaca acttctgatt aagcaagcag gtatcatagt ggacttaaat       420
     cctgatgcct cggatctata tgaacatgat attttgtata ttacacaaaa acaattagat       480
     gaagggaata ccggtattgc gcttacgaat tggcaaacat attacttgaa aagtgacaat       540
     agtggtcaaa tgaatggtcc tttagctcta aaatatatta ggcaggagtt tccaaatata       600
     aaaccaggta gtgcttcttt tgacctagag aaactttttc atgcactacc ggaagaaaag       660
     cgaaaactgg caacgataac ttcgaatcca gtaaaaccat ctgaaatttt tagttatacc       720
     tctgatgaac ttgctgagat aaagagacat aaactcgccg tcgttacaca atataaaaat       780
     gaagaatgtt cttctatttc tatgaaaatt agaaacaggg ataacgtctt gcgaacatgg       840
     gaggatagta tgaatatttc tgcttcatct aattggatcc cagaagatag gagcatattt       900
     acaattattc caattaaaaa aggatctaac aaggtgtaca tagaagcaaa ttcaacctat       960
     cttacatctg caaatggtga ggtgggcgtt acaggatttc gcgcttatgg acaagtatgg      1020
     acacttgtta attatggatt tgaaagcttc tctttaaaaa ataaccacgg acaatattta      1080
     tctgttaatg atacatccgt atgtctgact gacaagcctg ataaaaacac tatatttccc      1140
     attactattc aaaaagaaaa atggaatgag tggttagcta aatggtattc tagcaaataa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page