(data stored in ACNUC9435 zone)

EMBL: CP000904.PE138

CP000904.PE138       Location/Qualifiers
FT   CDS_pept        complement(188363..189040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5586"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: btl:BALH_1747 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5586"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46562"
FT                   /db_xref="GOA:A9VUJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ1"
FT                   /protein_id="ABY46562.1"
FT                   /translation="MTTILVVEEGITIRNFIVLIMNRAGFNALAADTGETALELLGKHN
FT                   VDIILIDVMLPGIDGFQVCKSIRENNKNIGIIMLSARVQDRDKVQGLTIGADDYIEKPF
FT                   SSIELTARVQALLRRVKGNKENMESIHSEPFRLNLQQERLYKEGVVIDLTPTEYIILRC
FT                   LMENQGKPISRDELLNEIWGVNYVVKTKVIGVNIRRLRQKIEPNPSGPQFLRTVWGKGY
FT                   VWR"
     atgacaacta ttttagtagt agaagaagga ataacgattc gtaattttat tgtattaatt        60
     atgaatcgtg ctggtttcaa tgcgttagca gcagatacag gagaaacagc tctcgaactt       120
     ttaggtaaac ataatgttga tattatatta attgatgtga tgttacctgg aatagatggt       180
     tttcaggtat gtaaaagtat acgagaaaac aataaaaata tcggtattat tatgttatcg       240
     gcacgtgttc aagataggga taaggtacaa gggttaacaa ttggagcaga tgattatatt       300
     gaaaaaccat ttagttcaat tgaattaaca gcacgtgtac aagcattact aagaagggta       360
     aaaggaaaca aagagaatat ggaatcgatt cattcggaac catttcgatt aaatcttcag       420
     caagaaagat tatataagga gggagtggta attgatttaa ccccaacaga gtatattatt       480
     ttacggtgct taatggaaaa tcagggcaag ccaatttcac gtgatgagct tttaaatgaa       540
     atatggggtg tgaattatgt agttaaaacc aaagtaatag gtgtaaatat aaggcgctta       600
     cgtcaaaaga tagaacctaa tccctctgga cctcagtttc tccgaacagt atggggaaaa       660
     ggatatgtgt ggagatga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page