(data stored in ACNUC9435 zone)

EMBL: CP000904.PE14

CP000904.PE14        Location/Qualifiers
FT   CDS_pept        31856..32605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5446"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46438"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV06"
FT                   /protein_id="ABY46438.1"
FT                   /translation="MEYLDNYLSVLPNYDRKEVEQLLQENMDLFDVKVITKEEFEALIQ
FT                   QLANRKEKVTTLTTTGEKVDAEHFNQIHSNVALDLKRLYNSHLIVEKVIANYDRILRGT
FT                   LDDVKREVDSLSTRVEELNLKAKGEDGLVVKTYGFEEKEKSLYMETDHDQYAHLFLDRD
FT                   GKSLQSASLNRSFHQHYLSLPIREVENTMQNSNGATTAKIEVMYQAPNSISDKNHPLEH
FT                   AIDDSLETYWAQAVKTNASAYTEIKKL"
     atggaatatt tggataatta tttatctgtt ctacctaatt atgatcgtaa agaagtagag        60
     cagctattac aagaaaatat ggatttgttt gatgtaaaag tcataacaaa agaagagttc       120
     gaagcactta ttcaacaact tgcaaataga aaagaaaagg ttacaactct tacgacaact       180
     ggtgaaaaag tcgatgccga acattttaac caaattcact cgaatgtagc tctggattta       240
     aagagacttt ataactcaca tcttattgtt gagaaagtaa ttgcgaatta cgacagaatt       300
     cttcgaggaa cattagatga tgtaaaaaga gaagtggact cactttctac tcgtgttgag       360
     gaattaaacc tcaaagcaaa aggagaagat ggtttagtcg taaagacata cggttttgaa       420
     gaaaaagaaa agagtttgta catggaaaca gatcatgatc aatatgcgca tttattctta       480
     gaccgcgacg gtaaatcttt acaaagcgca tcattgaatc gtagttttca tcaacactat       540
     ttatcactac ctatcagaga agtggagaac acaatgcaaa attcaaatgg ggcgacaact       600
     gcaaagattg aagttatgta tcaagcacca aatagcattt cagataaaaa ccatccattg       660
     gaacatgcaa tagatgattc acttgaaacg tattgggcgc aagcagttaa aacgaatgca       720
     tctgcttata cggaaataaa aaaactatag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page