(data stored in ACNUC9435 zone)

EMBL: CP000904.PE140

CP000904.PE140       Location/Qualifiers
FT   CDS_pept        complement(190019..190501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5589"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46564"
FT                   /db_xref="GOA:A9VUJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ3"
FT                   /protein_id="ABY46564.1"
FT                   /translation="MNTLIYNNDDGVNKMKQAKLNITLSLIQLFALVINLCMCSSTMRF
FT                   LPWFVKGAVRCYEIFLTAPLLLITGTVMTYHNTRKRHSILPIRQCISFITIIFFVSTFL
FT                   LPSTDEIVITSLIFNFGMVVITIVFLLKDIAQLNKNRKYRIKKKRIRRHSFGERMK"
     atgaacacac tcatatataa caatgatgac ggggtgaata aaatgaaaca agcaaaatta        60
     aatataacgt tatccctcat acaattattt gctttagtaa tcaacctatg tatgtgttcc       120
     tcaaccatgc gatttttacc ttggtttgtt aaaggtgctg ttagatgtta tgaaatcttt       180
     cttactgctc ctttattatt aattactggc accgttatga cataccataa tacaagaaaa       240
     aggcattcta tcctaccaat aagacaatgc atttctttta ttaccattat tttttttgta       300
     tccaccttct tattaccttc cactgacgaa attgttataa catcccttat atttaatttt       360
     ggaatggttg tcattacgat tgtatttttg ttaaaagata ttgcccaact taataagaat       420
     agaaaatata ggatcaaaaa aaaacgtatt agaagacaca gttttggtga aaggatgaaa       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page