(data stored in ACNUC9435 zone)

EMBL: CP000904.PE143

CP000904.PE143       Location/Qualifiers
FT   CDS_pept        complement(193378..194511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5593"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="KEGG: gtn:GTNG_3381 alanine dehydrogenase; TIGRFAM:
FT                   alanine dehydrogenase; PFAM: tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase; alanine dehydrogenase/PNT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5593"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46567"
FT                   /db_xref="GOA:A9VUJ6"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ6"
FT                   /protein_id="ABY46567.1"
FT                   /translation="MIIGVPKEIKNNENRVALTPAGVIPFVTAGHKVLVETNAGVGSGF
FT                   RNVDYVYAGAEIVESAAEVWNQSEMIMKVKEPLESEYIHFRPNLILFTYLHLAAESNLA
FT                   QALKDKRVTAIAYETVEVNHTRPLLTPMSEVAGRMSVQIGAQFLQKSNGGQGILLAGVP
FT                   GVNRGKIAIIGGGIVGTNAAKMAIGLGADVTIIDLNADRLRQLDDIFGTQIKTLMSNPF
FT                   NIAEAVKQADLLISAVLIPGAKAPKLVTEEMVQRMKPGSVIVDVAIDQGGAVETCDHVT
FT                   THDNPTFEKYEVLHYSVANMPGAVPRTSTIALTNVTIPYALQIANKGVQTAIFENDALK
FT                   LGVNTLNGEITCEVVAKELGYKYVSIEEAFAKRIVSN"
     atgattattg gtgtaccaaa ggaaataaaa aataatgaaa atcgtgtcgc acttacacct        60
     gcaggagtta ttccatttgt gacagctggc cataaggtat tagttgaaac aaatgcaggt       120
     gttggtagtg gctttagaaa tgtagactat gtatatgctg gtgctgaaat tgttgaaagt       180
     gctgcagaag tatggaatca gtcagaaatg attatgaaag taaaagagcc tctcgaaagt       240
     gaatatattc actttcgtcc aaatttaatt ttattcacat acttacattt agctgccgaa       300
     tctaatttag ctcaggccct taaagataaa agagttaccg ccatcgcata tgaaacagta       360
     gaagtaaacc atacccgccc tcttcttaca ccaatgagtg aggtagctgg acgcatgtct       420
     gtacaaatag gagcacaatt tctacaaaag tcaaacggtg gtcaaggtat tcttcttgca       480
     ggagtacctg gtgtgaatcg tggtaaaatt gccatcatcg ggggaggtat cgtcggtaca       540
     aacgctgcga aaatggccat tggccttggc gccgacgtaa caatcattga tttaaatgca       600
     gatcgtctac gacaactaga tgacattttc ggtactcaaa tcaagacatt gatgtctaat       660
     ccgttcaaca tcgcggaggc agtaaaacaa gcagatcttt taattagtgc cgtattgatt       720
     cctggtgcta aagctcctaa gcttgtcacc gaagaaatgg tacaaagaat gaagcctggc       780
     tctgtaatcg tggatgtagc gattgaccaa ggtggagctg tggaaacatg tgaccatgta       840
     acaacacatg ataatccgac atttgaaaaa tatgaagtgc ttcactattc cgttgcgaac       900
     atgccaggag cagttcctag aacatccact atcgctttaa caaatgtaac aattccttat       960
     gcactacaaa ttgctaacaa gggtgtacaa acagcaatat ttgaaaacga tgctttaaaa      1020
     cttggagtaa acacgttgaa cggtgaaatt acatgtgaag tggttgcaaa ggaacttggc      1080
     tacaagtatg tttccataga agaagcattt gcaaaaagaa ttgtaagtaa ttaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page