(data stored in ACNUC9435 zone)

EMBL: CP000904.PE144

CP000904.PE144       Location/Qualifiers
FT   CDS_pept        complement(194641..195873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5594"
FT                   /product="putative transcriptional regulator, PucR family"
FT                   /note="KEGG: gtn:GTNG_3380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5594"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46568"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ7"
FT                   /protein_id="ABY46568.1"
FT                   /translation="MTYMKNDSFRVTFDSLDEFADIVSEILQCPITIEDVNHRLLAYST
FT                   HDERTDPARIGTIMGRRVPEKVINNLWKEGIIPDLLKNREPIRVKKRDDIGLGDRVAIS
FT                   IWNKEDVLGFIWALEIEKSLTEQDCLLLKKYAEVVKSKLLQLQARKNQKEERSQEFFWK
FT                   LLTNHMQVNTEIMENFYLLQITPASLFTVSVFRFEQGITNEKEKQISYLLKTSQHLKVL
FT                   LYTIDRNQLILLTSLDNVKRPFHEINNFIEMFVHNMEKRYGIKSIKPAFSSVYSDYQKI
FT                   SKAYKETLTVLSIKEKFPSDTTNIHSYQNLGIYQLIDLLLEQRKDEEYENQALQKLDEY
FT                   DHKHNCNLIETLEVYLNKDSNVGEVAKALNIHANTLSYRLKRIYEISEIDLKDPNQKMI
FT                   LYLDLKLKKFM"
     ttgacatata tgaaaaatga ttcttttaga gttaccttcg atagtttgga tgaatttgct        60
     gatatagtta gtgagatttt gcaatgtccg attactattg aggatgtaaa tcatcgtctt       120
     ctcgcatata gtacccatga tgaaaggaca gacccagcga gaattggtac tattatgggg       180
     cgtcgcgtac ctgaaaaagt aatcaataac ctgtggaaag aaggaattat tcccgattta       240
     ttaaaaaatc gggagcctat tcgtgtaaaa aaaagagatg atattggtct cggcgataga       300
     gtcgcgatat ctatttggaa caaagaagac gttttaggat tcatttgggc tttagaaatt       360
     gaaaaatctt taactgaaca agattgtctc ttgctaaaaa aatacgcgga ggtcgtaaaa       420
     agtaagctgt tgcaacttca agcccgaaaa aaccaaaaag aagagcgatc acaagagttt       480
     ttttggaaac tgctaactaa tcatatgcag gtaaacacag aaattatgga aaatttctac       540
     ctgctccaaa taactccagc atccttattt actgtctctg tattccgttt tgagcaagga       600
     attacgaatg aaaaagaaaa acaaatttct tatttgttaa aaacaagtca acacttgaaa       660
     gttttacttt atacaattga tcgtaatcaa ttgattcttc ttacttcatt ggataatgtg       720
     aagcgccctt ttcatgaaat caacaatttc atcgaaatgt ttgtacacaa tatggaaaag       780
     cgatatggca tcaaatctat caagccggca tttagcagcg tatatagtga ttaccaaaaa       840
     atcagtaaag cttacaaaga aacgctaacg gttttatcca taaaagaaaa attcccttct       900
     gacacaacta atattcacag ctaccaaaac ttagggattt atcaattgat cgatcttcta       960
     cttgagcaaa gaaaagatga agagtatgaa aatcaggcgt tgcaaaagct agatgaatat      1020
     gaccataagc ataattgcaa tcttattgaa acgttggaag tctacttaaa taaagatagc      1080
     aatgttggcg aggtagccaa ggcattgaat attcatgcta atacacttag ctatagactt      1140
     aagcgtattt atgaaattag tgagattgat ttaaaagatc caaatcaaaa aatgattctg      1200
     tacttggatc tcaagctgaa aaaatttatg taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page