(data stored in ACNUC9435 zone)

EMBL: CP000904.PE146

CP000904.PE146       Location/Qualifiers
FT   CDS_pept        complement(198396..198992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5597"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_5935
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5597"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46570"
FT                   /db_xref="GOA:A9VUJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ9"
FT                   /protein_id="ABY46570.1"
FT                   /translation="MNKRGRPREFDYSSIVDVAMKTFWIRGYEGCSTQDLCSDTGLGKG
FT                   SLYNTFGSKHELYKQVLERYHEIGIREQKKLLDTPIPVKERLSNFFEWALKEDLENIDQ
FT                   KGCLLINASVERAKNDLMVQEIFSKHVELLKQAIETVMEEGLQTGEISKKQSAEELASL
FT                   LLSSYYGFRVLNVSMQNRMLAEQVIKGTMESIFGA"
     ttgaataaac gcggcagacc ccgagagttt gattattcct caattgtaga tgttgcaatg        60
     aaaacatttt ggataagagg atatgagggg tgttctacac aagatttatg cagtgataca       120
     ggacttggaa aaggaagttt atacaatact ttcggtagta aacatgaact gtataaacaa       180
     gtattagaac gctaccatga aattgggatt agggaacaaa agaaattgtt agatacgcca       240
     attccagtta aagaacgatt aagtaatttt tttgaatggg cattgaaaga agacttggag       300
     aacattgatc aaaaaggatg tttattgatt aatgccagtg tagaacgtgc taaaaacgat       360
     ttaatggtac aagaaatttt ctcaaagcat gttgagcttc ttaaacaagc tattgaaaca       420
     gtgatggagg aaggattgca aacaggtgaa atttcaaaga agcaatcagc tgaggaatta       480
     gctagtctgc ttttaagcag ttattacgga ttccgtgttc ttaatgtatc gatgcaaaat       540
     cggatgttag ctgaacaggt tatcaaagga acaatggagt ctatttttgg cgcttag          597
//

If you have problems or comments...

PBIL Back to PBIL home page