(data stored in ACNUC9435 zone)

EMBL: CP000904.PE15

CP000904.PE15        Location/Qualifiers
FT   CDS_pept        32621..33568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5447"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46439"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV07"
FT                   /protein_id="ABY46439.1"
FT                   /translation="MPTPIYIEQHYSLSVSEFEGLWEMTFMHPYNRQEHFSIYLVAPNS
FT                   DYEHAELDDRPIVEAGPRLTEVLKRLLYKIEYYPYSWDFAGKKIVSYGYDFETDFTGTS
FT                   LTYIDLTEIALKEVNEFYNFFSALKTDVVDETEKVSGKGVMAKLKITLDKPKTVNHLFI
FT                   DFFTEYPIELLSLMYQVDQNEESTTYEIPLSKAVQTNGSIYLHFSPVFAKTFYLIIKQE
FT                   SYTLLDQSKKEEEVMKAELWDQASTRSQSIYESAVGEYVDQLFSSKSGIQLHQEILDSY
FT                   QNINVSHASISSDPMNLYRSDFEQAKRSLDSQQR"
     atgcctactc ccatttatat tgaacaacat tattcattat ccgtatctga atttgaagga        60
     ctatgggaaa tgacatttat gcacccatac aatcgacaag agcattttag tatctatcta       120
     gttgctccta atagtgatta tgaacatgct gagcttgatg atcgcccgat tgtagaagct       180
     ggaccaagat taacggaagt attaaaacga ttactttata aaatcgaata ctatccttat       240
     tcttgggact tcgcgggaaa gaaaattgtt tcatatgggt atgattttga aacagacttt       300
     acaggtacca gtttgaccta tattgattta acggaaatcg cccttaaaga agtaaatgag       360
     ttttataatt tcttctctgc gttaaaaaca gacgtagtag atgaaacaga aaaggtcagc       420
     ggaaaaggtg ttatggccaa gctaaaaatc acgttggaca agcctaaaac cgtaaatcat       480
     ttgttcattg atttctttac agagtatcca attgagttac tttcattgat gtatcaagtt       540
     gaccagaatg aagaatcgac tacttacgaa attcctcttt caaaagcagt tcaaacaaat       600
     ggatcgatct atcttcattt ctctcctgta tttgcaaaga cattctattt aatcattaag       660
     caagagtctt atacattact agaccaatca aagaaggaag aagaagtaat gaaagcagag       720
     ttatgggatc aagcttcaac aagaagccaa tctatttatg agtctgcagt tggagaatat       780
     gtagaccaat tattctcttc taaatctggt attcagctgc atcaagaaat cttagatagt       840
     taccaaaaca ttaatgtaag tcacgcatct atttcatcgg atcctatgaa tttataccgt       900
     agtgattttg aacaagcaaa aagatcttta gatagccaac aacgatag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page