(data stored in ACNUC9435 zone)

EMBL: CP000904.PE150

CP000904.PE150       Location/Qualifiers
FT   CDS_pept        complement(204806..206035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5603"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: btk:BT9727_2894 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5603"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46574"
FT                   /db_xref="GOA:A9VUK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK3"
FT                   /protein_id="ABY46574.1"
FT                   /translation="MNNSIDIQHLCDLAHKAFNVPVHILSTDKKILYHSTSDDVCSPFY
FT                   SSKDEHLSDIYQENDPNNLPLFRCNSYLENFVLIHIANHDYIKGTIIIGPTIHPKGSDD
FT                   ITFKLRKEFNLNNNIQERLAYYQCLPEIKKTTLIDMGVLLHYMIFNEKLDVDIVLEKNK
FT                   VLEEVPYKIVKPDLYILKRQQNKPKTHNMALVHNYFSAIKEGDKKKLLQYMYAVSQEDV
FT                   ELILTADPLRNQKNHGIIAITLATRYAIEGNLPPDIAFALSILYIQTMEQLDNVDSVRR
FT                   LSGDALRTFADRVKEFNAQKFSNAVTTCMNHINKNVYDGISLNELANHLDITPTYLSKL
FT                   FKKEVGIPLSDYIQRVRVEEAKKLLTLTTYPLSDICAWLNFNDQSYFTRVFKKSTNMTP
FT                   RQYREKYTVI"
     atgaataatt ccatcgatat acaacacttg tgtgatctcg cacataaagc ctttaatgta        60
     cctgttcaca ttttatctac agacaaaaaa atcttatatc attctacttc tgatgatgtt       120
     tgtagtcctt tttattcctc taaagatgaa catcttagtg acatttatca agaaaatgat       180
     cccaataact tgccactttt cagatgtaac agttatcttg aaaatttcgt cctaattcat       240
     atagcaaatc atgattatat aaaagggact attataatcg gtcccactat acatccaaag       300
     ggctcagatg atataacctt taaacttcgg aaagaattta acttaaataa taatattcaa       360
     gaaagactag cctattatca gtgcctacct gagataaaaa aaactacttt aattgatatg       420
     ggagttttat tacattacat gattttcaat gaaaagttag atgtagatat tgttttagaa       480
     aaaaataaag tgctagagga agttccctat aaaattgtga aacctgatct atatatttta       540
     aaacgccaac aaaataaacc taaaacccac aacatggcat tagtacataa ttatttttca       600
     gcaatcaaag aaggagataa aaagaagtta ttgcaatata tgtatgcagt ttcgcaagaa       660
     gatgttgaat taattttaac agcggatcca ctcagaaacc aaaaaaatca tgggattatt       720
     gcgattactt tagctactcg atatgcgata gaaggtaacc tcccaccaga cattgctttt       780
     gctcttagta ttttgtatat ccaaaccatg gaacaactag ataatgtgga ctctgtaagg       840
     cgattgtcag gagacgcttt acgtactttt gcagatcggg tgaaagaatt caatgcacaa       900
     aaattttcaa atgctgttac tacatgtatg aatcatatta ataaaaatgt ttacgatgga       960
     atatccctca atgaactcgc taatcatttg gatattaccc ctacttattt atctaaatta      1020
     tttaaaaaag aagtggggat tcctttaagt gattatattc aaagggtacg agtggaagaa      1080
     gcaaaaaaat tattaacact cactacatat ccattatcag atatttgtgc ttggcttaat      1140
     tttaacgacc aaagttattt tacaagggtt ttcaaaaaat caactaacat gactcctaga      1200
     cagtatcgtg aaaaatatac tgtaatataa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page