(data stored in ACNUC9435 zone)

EMBL: CP000904.PE151

CP000904.PE151       Location/Qualifiers
FT   CDS_pept        complement(207859..209031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5606"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bcz:pE33L466_0056 integrase-recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5606"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46575"
FT                   /db_xref="GOA:A9VUK4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK4"
FT                   /protein_id="ABY46575.1"
FT                   /translation="MDKQNEKENLLIINNQSENIDTYVENIRDMVPFLHNNRYVDKVEE
FT                   KMEVAEKEGKSKYTYLSDLEVIYHFIHLQKDMDENKNRKEDTKKSYVSEILSFCQCMVQ
FT                   HAEEFELNGEEVQQNTSLLKTLQPWHIRKYNSWLKQVENGRNGDTYAVATLAKKTVLIR
FT                   SFLKHLHVFAYIEKPLHEELQRANVNEQDRPNRDLSYDEVMKILGFYKERGHLVNYTIL
FT                   LALASTGARIQELCTTRVKDLHYDGKYWLKVTGKGDKVRELFISEHLYQCICEMRRRRG
FT                   FQTVLDRGDESPLFVNQRGNFYNSKTLSNQVTDMIKKTNLEFLQYRENPVTAHTFRHAF
FT                   AIMAVEQGNADLYHLMQTLGHENIQTTKIYLEKHMKRKNNVGTSFADLLV"
     atggataaac aaaatgaaaa agagaactta cttataataa ataatcaaag tgaaaatata        60
     gatacatatg tagaaaacat aagagatatg gttccattcc tgcataataa tcgttatgta       120
     gataaagtag aagagaagat ggaggttgca gaaaaagagg gaaagagtaa atatacgtat       180
     ttaagtgatc tggaagtcat ttatcatttc atacatttac aaaaagatat ggatgagaat       240
     aagaatagaa aagaggatac gaaaaagagt tatgtttctg aaatcttatc attttgtcag       300
     tgtatggtgc agcatgcaga agaattcgaa ttgaatggag aagaggtaca gcaaaatact       360
     tctttattaa aaacattaca accttggcat attcgtaaat ataactcctg gttgaaacaa       420
     gtagagaacg gtaggaatgg ggacacatat gcagttgcaa cacttgccaa gaaaacagtg       480
     ctcattcgtt cttttttaaa acaccttcat gtatttgctt atatcgaaaa accccttcat       540
     gaagaactgc agcgcgcaaa tgtaaatgaa caggatcggc caaatcggga cctatcttat       600
     gatgaagtta tgaaaatctt agggttttat aaagaaagag gacatttagt aaactatacc       660
     attttactag ctctggcaag taccggtgca agaattcaag aattatgcac aacaagagtc       720
     aaagatttac actatgacgg aaagtactgg ttaaaagtca caggcaaagg ggataaagtg       780
     cgtgaacttt tcatttcgga acatttgtat cagtgtattt gtgaaatgag acgaagaaga       840
     gggttccaaa ctgtattgga tcgaggagat gaaagtcctt tatttgtaaa tcaaagaggg       900
     aacttttata attcaaaaac gttatcgaat caggtaacag atatgataaa aaagacaaat       960
     ttagagtttc tgcagtatcg tgagaatcca gtaacggcgc atacattccg tcatgcattt      1020
     gcaatcatgg cagttgaaca aggaaatgct gatttgtatc atttaatgca aacgctgggg      1080
     catgaaaaca ttcaaacgac aaagatttat ttagaaaagc acatgaaacg aaagaataat      1140
     gtgggtacct catttgcaga tctgttagtg tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page