(data stored in ACNUC9435 zone)

EMBL: CP000904.PE152

CP000904.PE152       Location/Qualifiers
FT   CDS_pept        209435..210436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5607"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bcz:pE33L466_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5607"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46576"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK5"
FT                   /protein_id="ABY46576.1"
FT                   /translation="MTQDLLFITKPTVTTKEAAGLLGVTVQTILQKEKDGLIECVYKDN
FT                   WKQFGSKIFYLEDIERIKNIEEVEGYSTKEAAEILNVATSTVFTYIKSGKLPASKIEKR
FT                   GKEVYIIDKDDLETFQLTYEKTTSKERKTFITKIQEEDIYLYQLLTHQHTGKTARVIEI
FT                   NGADGKILTEDEEIFPLSTYKEHDYSFEPFHKQAVITKRGYLSFSLKKPQLFNSIIYNL
FT                   INLFYKELGVTNMRLSISSDTIKLEIKPFVLQVDPLQFQEEIKYLHSHMKSGTILPHVE
FT                   GIYFKSNVEPLTFHADHEFKQKVVQMAADAGMGQEEFLLQAVKFYITNLEKA"
     atgacacaag atttattgtt cattacaaaa cctactgtaa cgacaaaaga ggcagccggc        60
     ttattaggag taacggtaca aacaatttta caaaaagaaa aagatggatt aatagaatgt       120
     gtatataaag ataattggaa gcaattcggt agtaagattt tctatttaga ggatattgaa       180
     cgtataaaaa atattgaaga ggttgagggt tatagcacaa aagaagcagc tgaaattctc       240
     aatgtagcaa catctacagt ttttacatat atcaaatctg gtaaattacc tgcttcaaag       300
     attgaaaaac gtggaaaaga agtatatatc attgataaag atgaccttga aacttttcaa       360
     cttacttatg aaaaaactac atcaaaagag cgaaaaacat tcattactaa gattcaagaa       420
     gaagatatat atttatatca attattaaca catcaacata ccggaaaaac agctagagta       480
     atagagatca atggagcaga cggcaagatt cttacagaag acgaagaaat tttccctcta       540
     tccacttata aggaacatga ttactccttt gaacctttcc ataaacaagc tgtaattaca       600
     aaacgagggt atttatcttt ttcattaaaa aaacctcagc tatttaattc catcatttat       660
     aatctaataa atttatttta taaagagcta ggtgtcacaa atatgcgctt gagtatttca       720
     tctgatacta ttaaattaga aattaaacct ttcgtattac aagttgatcc attgcaattt       780
     caagaagaga ttaaatactt acattctcat atgaaatccg gcacgatact tccacatgta       840
     gaagggattt attttaaaag taatgtagag ccattaactt ttcatgcgga tcatgaattt       900
     aaacaaaaag tagttcaaat ggccgcggat gctggtatgg gacaggaaga attcttattg       960
     caagctgtaa aattttatat aacaaattta gaaaaagcgt ag                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page