(data stored in ACNUC9435 zone)

EMBL: CP000904.PE153

CP000904.PE153       Location/Qualifiers
FT   CDS_pept        complement(211684..211911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bat:BAS3052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5608"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46577"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK6"
FT                   /protein_id="ABY46577.1"
FT                   /translation="MEEIIKEIVSPSKRYKVQVIKRNDGFFSTEVFAWFEDYGYEYWAP
FT                   IKQGLSLIDTEKHAIAIAMEDLKVYSGEND"
     atggaagaaa tcattaaaga gattgtttcg ccaagcaaaa gatacaaagt ccaagttatc        60
     aaacgaaatg atggtttttt cagtacagaa gtttttgcgt ggtttgagga ttacggatat       120
     gagtattggg ctccaattaa acaggggtta tcgttaattg atacagaaaa acatgccata       180
     gccatagcaa tggaagactt aaaagtgtat tcaggtgaga atgattag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page