(data stored in ACNUC9435 zone)

EMBL: CP000904.PE154

CP000904.PE154       Location/Qualifiers
FT   CDS_pept        complement(212314..213072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5609"
FT                   /product="protein of unknown function DUF975"
FT                   /note="PFAM: protein of unknown function DUF975; KEGG:
FT                   bat:BAS2476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5609"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46578"
FT                   /db_xref="GOA:A9VUK7"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK7"
FT                   /protein_id="ABY46578.1"
FT                   /translation="MTRNLKKAALNSLDGKWGGGIGGSALNYFVPTLSASAIATFMYLI
FT                   VGLFIGLIGLDVIFVYSISGQPQVDPTALVLLILSYIFLGLICFLIYSSIQGIFNYGYS
FT                   AFTLHLGKNEDAKVDDVFLGFKKSNLFRSIKLGLLQAIFLFLWSLLLIVPGIIKYFSYS
FT                   MSYYILVENPDYTASEALRESKRIMKGQKLKLFVLWLSFIGWFLLAVFIGMFTFNLSFI
FT                   FISPYYNTTVSHFYLDLIKKQDAGEAKVSI"
     atgacaagaa atttaaagaa agcagcactt aattcgttag atggtaaatg ggggggaggt        60
     ataggaggat cagcgttaaa ctattttgta cctactctta gtgcatcagc aatcgcgaca       120
     ttcatgtatt taatagttgg cctgtttatt gggttaattg gtttggatgt aatctttgtt       180
     tattcaatta gtgggcaacc ccaagtagac cctactgcac tagttttact tattctaagt       240
     tatatttttt taggacttat ttgtttctta atttacagtt ccatacaagg catctttaat       300
     tatggatatt ctgctttcac cttacattta gggaaaaatg aagacgctaa agtggacgat       360
     gtatttctag ggtttaagaa aagcaatttg tttagatcaa taaaattggg actgttgcaa       420
     gctatttttc tttttttatg gagtctctta ttaattgttc caggtattat taaatatttt       480
     tcttattcca tgtcgtatta catattagta gagaatcctg attatacagc aagtgaagca       540
     ttgagggaaa gtaaaagaat aatgaaagga caaaagctaa agttatttgt tctttggtta       600
     tcatttattg gttggttttt attagccgta tttataggaa tgtttacatt taatctatca       660
     tttattttca tttctcctta ttacaacaca actgtctcac atttttactt agatttaatt       720
     aaaaaacagg atgctggaga agcgaaggta agtatataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page