(data stored in ACNUC9435 zone)

EMBL: CP000904.PE155

CP000904.PE155       Location/Qualifiers
FT   CDS_pept        213825..214136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5611"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: btk:BT9727_4158
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5611"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46579"
FT                   /db_xref="GOA:A9VUK8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK8"
FT                   /protein_id="ABY46579.1"
FT                   /translation="MNCNDKVMHILENLRPCFQGLGDPTRQQIVSLLIDKDSLNVTQIA
FT                   EHIPMSRPTVSHHLKILKQSGLLQVQKKGTEMYYCLEFNETINLLKELVSLVEDECKN"
     atgaactgta atgataaagt aatgcatatt ttagaaaatt taagaccatg ttttcaaggg        60
     ttgggagatc caactcgtca gcaaattgta tcacttttaa ttgataaaga tagcttgaat       120
     gtgacgcaaa ttgcggagca tattcccatg tcaagaccta ctgtatctca tcatttgaaa       180
     atattgaaac aatctgggtt acttcaagtt cagaaaaaag gcactgaaat gtattattgt       240
     cttgaattta atgaaacaat aaatctttta aaagaacttg tttctttagt tgaagatgaa       300
     tgtaagaatt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page