(data stored in ACNUC9435 zone)

EMBL: CP000904.PE157

CP000904.PE157       Location/Qualifiers
FT   CDS_pept        215957..217294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5613"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: bay:RBAM_005580
FT                   YvdP"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5613"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46581"
FT                   /db_xref="GOA:A9VUL0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL0"
FT                   /protein_id="ABY46581.1"
FT                   /translation="MGSTKLTGRVIFKGDPGYKEAIKNWNPYVNVFPLVFVFAQNACDV
FT                   SNAIKWARKNCVPLRVRSGRHALDKEFSVVKGGLVIDTSDMNKVHLDKKKGIATVQPGI
FT                   RVGPLVKKLAQEGFMAVFGDSPTVGIGGITTGGGFGVLSRSIGLISDNLLELEMVDAKG
FT                   KIHRANSSHNEDLFWASRGGGGGTFGYNTEYTFKVHPAPKTATVFNIVWPWEQLETVFK
FT                   AWQNLMPFVDERLGCILEILSKVNGLCHATGLFLGSTSELKQILAPLLCAGTPTEIVIK
FT                   TLSYPECIDFLDPPEPPFADQNFKFSSSWSNNLWTEKPIAVMKQFLEKAPGTESEFYFQ
FT                   NWGGAIRNVPKDETAFYWRTPLFYTEWNATWVDPSEEASSLASVEKVRKLLKPYTVGSY
FT                   VNVPDESIKHFGNAYWRSNFKRLQKVKTKYDPENVFHHPQSIPPFC"
     atgggatcaa caaagttaac aggacgagta atcttcaaag gggaccccgg ctataaagaa        60
     gcaattaaga attggaaccc ttatgttaat gtctttcctc ttgtctttgt ttttgcgcaa       120
     aatgcatgcg atgtaagtaa tgccattaaa tgggctcgta agaattgtgt accactgcgt       180
     gtcagaagtg gccgccatgc tctagataag gagttctccg ttgtaaaggg tggacttgtt       240
     attgatacga gcgatatgaa taaagttcac ttagataaga aaaaaggaat tgctaccgtt       300
     caaccgggaa ttcgcgtggg ccctcttgta aaaaaattag cccaagaagg tttcatggcg       360
     gtgtttggag atagtccaac cgttgggatt ggtggaatta caactggcgg cggatttgga       420
     gtactctcac ggtcaattgg tttaatatcc gataacctcc tcgaactaga gatggtggat       480
     gcaaaaggaa aaattcatcg cgcaaattca tctcacaatg aggacttatt ttgggcctct       540
     agaggcggcg gtggcggtac ctttggatat aataccgaat acacgtttaa agttcatccc       600
     gcccccaaaa ccgcgacggt ctttaatatt gtttggccat gggagcaatt ggaaacggta       660
     tttaaagctt ggcaaaattt gatgccgttt gtagacgaac gattagggtg catacttgag       720
     attctcagca aagtaaatgg actgtgtcat gcaactggac ttttcttggg ttccacttct       780
     gagttgaaac aaattttagc acctttacta tgtgctggta caccaacaga aatagttata       840
     aaaacacttt catatccaga gtgtatcgat ttcctcgatc ctccggaacc accctttgca       900
     gatcaaaatt ttaaattctc ttcatcttgg agtaacaacc tttggacgga aaaaccaatt       960
     gcggtcatga aacaattttt agaaaaagca ccaggaacag aatccgaatt ctattttcaa      1020
     aattggggag gtgccattag aaacgtaccg aaagacgaaa cagccttcta ttggcgcact      1080
     ccactgtttt acacggaatg gaatgctact tgggttgatc catcagaaga agctagtagt      1140
     cttgcatcag tcgaaaaagt gcgtaagctg ttaaaaccat atacagttgg ttcatatgtt      1200
     aacgttccag acgaaagtat caaacatttt ggaaacgcct attggagatc aaactttaaa      1260
     agacttcaaa aagtaaaaac aaaatatgat cccgaaaatg tatttcatca tccacagagt      1320
     atcccaccat tttgttaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page