(data stored in ACNUC9435 zone)

EMBL: CP000904.PE159

CP000904.PE159       Location/Qualifiers
FT   CDS_pept        complement(218356..219078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5615"
FT                   /product="Oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /EC_number="3.1.2.14"
FT                   /note="PFAM: Thioesterase; KEGG: bce:BC2458 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5615"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46583"
FT                   /db_xref="GOA:A9VUL2"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL2"
FT                   /protein_id="ABY46583.1"
FT                   /translation="MQKTKLFCFPHAGGSAFSYAKWKNYFNPYIEVVPIELAGRGYRIE
FT                   ESLYQSMEEAVNDVYTSIVKQIEHSPYILYGHSMGSLIAYEVARKIQDSKNVLPEFLVL
FT                   SGRNHPNSKMKNIRHNLSNEQFKREVIAMGGTPSGVLQSEELMGIFLPILRADFKIVET
FT                   YIHDNNMQACDIDFLIFNGENDEFTTYNQVIKWEQYTSKTCTFHSFKGNHFFLNENIEE
FT                   IANRIIRKLDSKRFSTSF"
     atgcagaaga ctaaactttt ttgctttcca catgctgggg gatctgcgtt tagttacgca        60
     aaatggaaaa attactttaa tccatatatt gaagtagtcc caatagagtt agctggtaga       120
     ggatatagaa ttgaagaaag cttgtaccaa agtatggaag aggccgtaaa tgatgtctac       180
     actagtatag ttaagcagat agagcattcg ccctatattc tatatgggca tagcatggga       240
     agtttgattg cctatgaagt agccagaaaa atacaagatt ctaaaaacgt attgcctgaa       300
     tttcttgttt tgtccggtag aaaccaccca aatagtaaaa tgaaaaatat ccgacataat       360
     ctttctaacg aacaatttaa aagagaagtt attgcaatgg gaggtacacc gtccggggta       420
     cttcaatcag aagaattaat gggaattttc ctcccaattc taagagcaga ttttaaaatt       480
     gttgagacat atattcatga caataatatg caagcatgtg atattgattt tcttatattt       540
     aatggggaaa atgatgaatt tactacatat aatcaagtaa taaaatggga gcaatacaca       600
     agtaaaacgt gtacttttca ctcttttaaa ggtaatcatt tctttctaaa tgaaaatatt       660
     gaagaaatag caaatagaat tataagaaag ttagattcta aaagattttc aactagtttt       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page