(data stored in ACNUC9435 zone)

EMBL: CP000904.PE16

CP000904.PE16        Location/Qualifiers
FT   CDS_pept        33583..34797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5448"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46440"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV08"
FT                   /protein_id="ABY46440.1"
FT                   /translation="MVNSFESASKPKTTLLQSQSATSSTTPGPLPPIVEGIGSSNRTNS
FT                   STEYVYQYGIKNLQLNHSLYEQAGIFVTKPIEVEGNIVEVSLSIFEDHPLFNELNGMAT
FT                   DRVTSIEYYISLEENPSLNDWVSILPEGTRNVRCEKLFFRGSSAELRFHADISDEDNTR
FT                   VYRNNILMNRSDWYFTERGAAIQLTVPHDNSSIYTIDYVPNANLFDPWTVKVGDRFSKR
FT                   VRKVESFPNGTDYNNTIKLSKYPYVDYKQVNSEESYDPNTSDYRPIDVFLTSGSIVVEG
FT                   GKTQQEFFPISYSSKNEFTTKNRTDYKTNKDVFLNKYSIVPDSVYNTFEYKQEKNKLIF
FT                   TESFNRSDLYYNEATNHGNATVVVHYDYLVTNFRLKVILRKNVGDELVVTPMVDSYQLK
FT                   FKVMK"
     atggttaaca gttttgaaag tgcaagtaaa ccaaaaacaa ctttactaca aagtcaaagt        60
     gctacaagta gcacaacacc tggaccgctt cctccaatcg tagaaggaat tggttcaagt       120
     aaccgtacaa atagttcaac agaatatgtt taccagtatg gaataaagaa ccttcaatta       180
     aatcattctt tgtatgaaca agctggaatt tttgttacaa aaccaattga agtagagggt       240
     aatattgtag aggtttcatt atctatcttt gaagaccatc cgctgtttaa tgagctaaat       300
     gggatggcaa cagatcgggt cacttctatt gaatactaca tctcattaga agaaaatccg       360
     tcacttaatg attgggtttc aatccttcct gaaggtacaa ggaatgtgag gtgtgaaaag       420
     ctattcttcc gtggctcaag tgcggaactt cgattccatg cagacattag tgatgaagat       480
     aatacaagag tataccgcaa taatatttta atgaatagga gtgactggta ctttacagaa       540
     agaggagctg ctattcagtt gactgtgcct catgataata gttcaattta cactattgat       600
     tatgtaccaa acgcaaactt atttgaccct tggacagtta aggtaggaga tcgattttct       660
     aaaagggttc gtaaagtaga gtctttccca aatggaactg attataacaa tacaattaag       720
     ctttctaagt atccatatgt tgattataaa caagtgaaca gtgaagagag ttatgatccg       780
     aatacaagtg attacagacc aattgatgta tttctaacga gcggttcaat cgtagtagag       840
     gggggaaaga cacaacaaga atttttccca atctcttatt caagcaaaaa tgaatttaca       900
     acaaaaaacc gtacagatta taaaactaac aaagatgtat ttttaaataa gtacagtatt       960
     gttccggatt ctgtttacaa cacatttgag tataagcaag agaagaataa actcattttc      1020
     acagaaagct ttaatcgctc ggatctttat tataacgaag caacaaatca tggtaatgcg      1080
     acagtggttg ttcactacga ttacttagtg acaaactttc gattaaaagt tatcttgcgt      1140
     aaaaacgtag gtgatgaact agtggtaacg ccaatggttg atagctacca attaaaattt      1200
     aaagtcatga agtag                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page