(data stored in ACNUC9435 zone)

EMBL: CP000904.PE161

CP000904.PE161       Location/Qualifiers
FT   CDS_pept        complement(220192..235098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5617"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: non-ribosomal peptide synthase; amino acid
FT                   adenylation domain; PFAM: AMP-dependent synthetase and
FT                   ligase; Thioesterase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: bce:BC2456 peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5617"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46585"
FT                   /db_xref="GOA:A9VUL4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL4"
FT                   /protein_id="ABY46585.1"
FT                   /translation="MRSDLHAKLSSLSPEKRAWLQKRMQKKENKEALPLSYAQQRLWFM
FT                   DRFNPNSSLYNIPTVWHLKGNWIPEALEKGFNRLIERHESLRTVFKEVGEQPVQQIVEF
FT                   LPRALPVRDYSQLPLEVKEKEVDSLIAREAQEPFDLMNGPLIRNQLVQLGKDEWLLLCT
FT                   MHHIISDAWSIGILMNELLTFYEEETGGNPAKLSSLSIQYADFAKWQKEWLQGDVLNRQ
FT                   LTYWEEELSGELPILQLPVDRPRPVTQTYAGDTHHVIFPYRLLNQLKDISRQEGSTLFM
FT                   TLMAAYQSFLARYTGQKDILVGSPIANRNHKGVEGLIGFFVNTLVYRSDLSGTPTFREI
FT                   LNQTKKKALKAYEYQDIPFEKVVEAVQPERSMSHSPIFQTMFTLQNIKQERLDLSGRSI
FT                   EMVESNMSIVKFDLSLTAYEVEEGLFVSFEYNTDLFDSSTVARMAGHFENWLNEIAYHP
FT                   DESYTKLSMLSDTEQKQLLEEWNDTDVVYGHEYMIHELFEQQVARTPDAVAVVYEGGKL
FT                   TYQELNEKSNQLAHYLQKRGIGPESLVGICVERSPEMIIGLFGILKAGGAYVPLDPSYP
FT                   ENRLRYILENSQIQVLLTKEALQDWLPKDIQAICLDRDQVMISKESNLAPVSGVTANNL
FT                   AYIIYTSGSTGNPKGVMIEHHSVINRLQWMQKKYPLSEEDTILQKTPFSFDVSVWELFW
FT                   WSFVGARVCLLQPGGEKDPAVIEEYIERYRVTTMHFVPSMLSTFLDYMEQYNSKRDESS
FT                   LNQVFTSGEALNTEQVRRFKGVFYDVQQTKLINLYGPTEATVDVTYYDCDLEKEPMLIP
FT                   IGRPIDNTELYVLDQYQQVVPIGVAGELYLGGVGLARGYFNRPELTTERFIPHPFKEGE
FT                   RLYRTGDLVRYMNDRNLEYIGRIDNQVKIRGFRIELGEIEAALHDHSSVKEAVVLVKED
FT                   RPGDKQLVAYVVGEGDTGEWREYLKKQLPNYMVPAYFFQVESMPLTPNGKVDRKALLEL
FT                   EAQFISEDITSSRTPVEELIVSVWSKVLGIRNISVQDSFFEIGGHSLLATQVVSRLQEI
FT                   FQIELPVRELFEYATVESLAKRLDQLRKGDRKRDIPPLMPMERGETIPLSYAQQRLWFI
FT                   DQFTPNSALYNMPIVCRLTGSWLPEALETGWNQLIERHESLRTVFHEVNGQPVQQIEPY
FT                   AFRLIPKTDLTMLSPEGREEEVKRLIQQETEMPFDLGEGPLIRTSILQVGEEEWILLCT
FT                   LHHIISDGWSMEVLLEEWMAFYEKATDGKIAELEPLPVQYADFAQWQKGWLKAEVLDQQ
FT                   LQYWKEELSGELPVLQLPMDRPRPAIQTHDGSTYTLVLPSALHDKLNEFSLQEGATLFM
FT                   TLLAAYQSFLSRYTGQEDILVGSPIANRNYREIEGLIGFFVNTLVYRANLSGRPTFQDV
FT                   LSQVRQKALKAYEYQDIPFEKIVEVVQPERSTSHSPIFQTMFILQNLKQEFPVLSGRSI
FT                   EMIESHSPIAKFDLSVMVAETEEGVRFTFEYNKDLFNATTIERMAGHFEKWLHEVSHHP
FT                   KNPLHSLSMLSEPERTLLLETWNDTVMEMPPQGLICDRFEEQVAKRPEAIAVVDQTKDW
FT                   TYGELDAQANQLANVLQRKGVAPESVVGVYLPRSAELMVSLLGILKAGGAYVVLDPLYP
FT                   KSRLEYMIEDAGIQFVVTAEGQEGLFEQVEMVRLEELTVESVIAPTRQINPENLAYIVY
FT                   TSGSTGKPKGVMIEYRSLMNMVSWHHEVYRITAEDRATQIAGIAFDSAVQEIWPYLTAG
FT                   AALYLSTEELRINPEALRDWLIDSRITASFAPTPILERLLKLSWPDKTDLRFIITGGDQ
FT                   LTQYPSNDIPFAVINQYGPSENTVVTTDCYVPVGVTTGTPSIGRPIANTEVYVLDSHLQ
FT                   LVPSGVIGDLYIGGKSLARGYANRPDLTKEKFISHPFKSGERLYYTGDKASYLSDGALQ
FT                   FHGRIDDQVKIRGFRIELGEIEAVLQAHSSVKEAVVLVREDDPGDKRLVAYVVGEGSVQ
FT                   EWREHLQTHLPNYMVPTNFIEMEFLPLTPNGKLDLKALPIPSKLSTENTVHARTPLEEL
FT                   IASVWSQVLGIENIGVQDSFFELGGHSLLATQVVSRLQEVFQIKLPVRELFEYSTVEAL
FT                   AKRLDQLRKGGKKREIPPLMPMERGNAIPLSYAQQRLWFIDQFTPNSALYNMPMVCRLT
FT                   GNWLLEALEVGWNQLIERHESLRTVFHEVDGHPVQKIQPYTFRSLPQIDLTKISPEERE
FT                   REVEQWIQTEVESPFDLEQGPLFRGQIVKISEEEWVLLCNMHHIISDGWSMEILLQEWM
FT                   AFYEEAIGEKPADLAPLPVQYADFAQWQREWLIDEVLNQPLAYWKEELSGELPVLMLPM
FT                   DRPRPPVQTHHGLTHNVLLSRSLLDKLNELSRQEGATLFMTLLASYQSFLARYTGQSDI
FT                   LVGSPIANRNYREIEGLIGFFVNTLVYRADLSGAPAFQELLSQVRIKALKAYEYQDVPF
FT                   EKIVEVIQPERSTSYSPIFQTMFTLQNTGQELPKLHGRSIEVMDSHASIAKFDLSLTAA
FT                   EVEEGLLLTFVYRTDLFDSLTIESIAENFGNWLNLIVEQPDKSLAKLPILSGLQQKQLE
FT                   EWNNNAVAYPQEFGIHQLYEEQVNRTPDAVAVVDEKQQLTYRELNEKANQLAHYLQKCG
FT                   IGSESLVGLCFQRSAEMIVGLMGILKAGAAYVPLDPSYPESRLRYILEDTGIQVLVTNE
FT                   ALEGWITEEIKTVCLDRDKAMISRESTLSPICEVTGENLAYVIYTSGSTGNPKGVMVEH
FT                   HNVIRLFKSTECWYQFDEKDTWTLFHSYAFDFSVWEIWGALLHGGRLIVVPYWISRSPK
FT                   DFYQLLVKEKVTVLNQTPSAFRQLIQVCEQEDEKKDLHLRYVIFGGEALDPTSLVPWFQ
FT                   RYGGQEPQLINMYGITETTVHVTYYPITQDDVQHASRSNIGKQIPDLEVYVLDACQQPV
FT                   PIGVAGELFIGGAGLARGYLNRSELTAERFIPHPFSSDPGARLYRTGDLARYLPDGNLD
FT                   YLGRIDHQVKIRGFRIELGEIESALNAHVSIKEAVVIVREDQPGDKRLVAYVVGDGNVG
FT                   EWRDYLKAELPSHMVPSGFVMMEAIPLTANGKVDRKALPVPEERKIESECVATRNGNEE
FT                   TLATIWKQVLGIKKVGIHDNFFEIGGDSILSIQIVSRAKQAGLQLTPKQMFEHQTIAEL
FT                   AQVVNEERGVQAEQGVITGELILTPIQQWFFAQDHPNPHHWNQSMFFRTKERLDIVLLE
FT                   KAVRTLLIHHDALRLRYERLPNGAWKQWNEGIEEQSTLTVISLDEVPQAEWHQVIQAEI
FT                   DTAQASLHLHAGPLMRMVYFDEGEKRAGRLFWVIHHLAVDGVSWRILLEDLQTAYNQAS
FT                   QDQMIQLPTKSTSFKAWSEKLHHYAEAGIVQEVRDYWEQQSEQEVAMLPVDTTLEVPAN
FT                   TGTEEITVVLDEKETRTLLKEISSTHRVQINEVLLTALVQATAVWTGHPALTVDLEGHG
FT                   REEIIEDVDLSRTVGWFTSIYPVHLNITGADTPIAALKAVKEQVRKIPNKGVDHGILRY
FT                   LNTTICEQWGSQHTPSISFNYLGQFDQMFSDDAILIPENGFKRLDHASGSKRSHLIDVI
FT                   GMVTDGKLQFTWVYNVGQYAKSTIQSIAENMLHQLSKLIQSAGGESALTVSDFVMANLD
FT                   QASLTKVLTKMNRGNNYPITDLYPLSPLQEGMIFHTLHDQGEEHVAPYIVQLSFMIRGE
FT                   LDIATFEQAWKSVIQRHEIFRSAFLWDEVEEPLQVVYESVPFKVNVEDWRTLTAEEKEE
FT                   KRKAFLALDRKQAFLFDKAPLMRVTVIQEGEEEYRIVWTHHHILLDGWSLPLVFNELLT
FT                   VYQKRMNGEAVHLPNSSPYKKYIQWLREQNQEQAEQFWREKLKGFTAPTLLGLESKEQE
FT                   KGYTEKVTYLSEEQTQALQNWAKRNRLTLNTVIQGAWAYLMSRYSGEDEIVYGVTSSGR
FT                   PTEIIDVENIVGPFITTSPTRIQLIDNIKVMDWLLKIQEEEIERRQYEYASLTEIQGWS
FT                   EIPRGTPLFHSLYVFENYPVKEGSSGNLEIGELEGVEQTHYPLGLTVVPESQLLLKLKY
FT                   DRSKFNGLTIERMLGHLSQVLKQMIENVDQTLSELVYVTEIEQKQLLEEWNDNAAAYPR
FT                   ESVIHKLFEDQVDRTPDAVAVVDENQRLTYRELNEKANQLAHYLQKMGIGTESLVGLCF
FT                   QRSVEMIVGLMGILKAGSAYVPLDPSYPESHLRYILEDTGIQILVTNEVSQGWMPEEVE
FT                   TVCLDRDQAMISQENTLSPICKVTGENLAYVIYTSGSTGNPKGVMVQHHSVLNLSYGLQ
FT                   KEVFSHRAHDNMRVGLNASIAFDSSVKQLQMLLYGSSLYIISTEVRSDPQQFISYIREN
FT                   KLEMFDITPSLLQLLIDEGLLETNDSVHVPSKVLVGGEAIMPSLWEQLVENDHIHFYNV
FT                   YGPTECTVDATCYRIKKDSKRVTIGRPLPNVQAYVLDEKLLPVPVGVTGELYIGGAGLA
FT                   RGYLNRPELTLERFIPHPFNEGERLYRTGDLVRYLADGHLDYLGRIDNQVKIRGFRIEL
FT                   GEIEANLESHPSVKEAVVLIREDQPGDQRLVAYVVGEGSMHEWREHLKRQVPNHMIPAH
FT                   FIEVDAIPLTTNGKVDRKALNSLTIQRENTFSTPIIPRDEIEYQLITIWQDLLQLEDIH
FT                   VNDDFFNIGGHSLLVIKLISKVREKFGKEIKVPALIKNPTVEGIACLIRENHRMEESLS
FT                   VLVPLQESEKRPFFCVHPFMGNVLCYIQLARLLKDHCSFYGLQNPLVEKEGMNGLILSE
FT                   VVQLYIEEMKRAQPEGPYRLGGWSLGGAIAYEIATMLRNQGEEVEVLVLLDTKVPSERD
FT                   YKTEDDMLSYILEHFIHIELVDQEEELVHQQDMLVEQLIVEGVLPPDANLTNLKQLINA
FT                   HRKCLNLMAEHDLTPYFGEVIYFSAEEGKELFTDWKPLLKGRVNMYSVPGSHEEIVASP
FT                   AVEKLAKYLLNELEGIKETSLSLTEK"
     atgagaagtg atttacatgc aaagctgagt tcactttctc ctgagaaaag agcttggctt        60
     cagaagcgaa tgcaaaaaaa ggagaataaa gaagcacttc cgttgtctta tgcacaacaa       120
     cgtttgtggt ttatggacag atttaaccca aacagttctt tatataatat tccaacggta       180
     tggcatctaa aaggaaattg gattcctgaa gcattagaaa agggattcaa tcgactcatt       240
     gaacgtcatg aatcattacg aaccgttttt aaagaagtag gagaacaacc tgtacaacaa       300
     attgtcgaat tccttcctag agcattacct gtaagggatt actcgcaact tcctctagaa       360
     gtaaaagaaa aagaggtaga tagtttaatt gcgagagaag cgcaagaacc atttgattta       420
     atgaatggcc ctttaattcg taatcagctt gttcaattag gaaaggatga atggttatta       480
     ctatgtacga tgcatcatat tatttctgat gcttggtcca tcggtatact catgaatgaa       540
     ttacttactt tctatgaaga agaaacgggc gggaatcctg ctaaattaag ttcactatcc       600
     attcaatatg cagactttgc aaagtggcaa aaggagtggt tgcaaggtga tgtgttaaat       660
     cgtcaactta cgtattggga ggaagaattg tctggggagc ttcctatatt acaactgcca       720
     gtggaccgac ctcgaccggt tacgcaaact tacgctgggg atacgcatca cgtgattttt       780
     ccttatagat tactcaatca attaaaggat ataagtcgac aagaaggatc taccttattt       840
     atgactttaa tggctgcata ccagagcttt cttgctcgtt atacggggca aaaagatatt       900
     ctagtcggaa gtccgattgc aaatcggaat cataagggag tagaaggatt aatcggtttc       960
     tttgttaata cgttggttta ccgatcagat ttgagtggca cccctacttt tcgggagatt      1020
     ttgaaccaaa caaagaaaaa ggcgttaaaa gcttacgaat atcaagatat accatttgaa      1080
     aaagtggtag aagctgtaca acctgaacga agtatgagtc attctcctat ctttcagacc      1140
     atgtttacac tacagaatat aaaacaagaa cgactagatt tgtctggtag aagtatcgaa      1200
     atggtagaaa gtaatatgtc tattgtaaaa tttgatctga gtttaactgc ctacgaagtg      1260
     gaagaaggcc tatttgtctc atttgaatac aacacggatt tatttgatag tagtaccgtt      1320
     gcacgtatgg caggccattt tgagaactgg ttaaatgaaa tcgcgtatca tccagatgaa      1380
     tcatatacaa agctgtcaat gttatcggac acagagcaga aacaactcct agaagaatgg      1440
     aatgatactg acgtagttta tggtcatgag tatatgattc atgagctatt tgagcagcaa      1500
     gttgcacgta cacctgatgc agtggcggta gtttatgagg gtggaaagct aacgtatcaa      1560
     gaactcaatg aaaaatcgaa tcaattggca cattatctac aaaaacgagg tataggacct      1620
     gaatcattgg tcggtatatg tgttgaacgt tctcctgaaa tgattattgg tctctttggg      1680
     attttgaaag caggtggggc ttatgtccca ctggacccaa gttatcccga aaatcgcctg      1740
     agatacattt tagagaattc acaaattcaa gtgctgttaa caaaagaggc actacaggac      1800
     tggttaccta aagatattca agcaatttgt ttagatcggg atcaagtaat gatttctaaa      1860
     gagagtaatt tggctccggt gagtggagta acagcaaata acttagccta tatcatatac      1920
     acttcgggtt cgacgggaaa tccgaaggga gtaatgattg aacatcattc ggttatcaac      1980
     cgcctacagt ggatgcagaa aaagtatcca ttatctgagg aggatacaat cctacaaaag      2040
     acaccgtttt catttgatgt ttctgtctgg gaattatttt ggtggtcatt tgtaggagcg      2100
     cgtgtttgtt tgcttcaacc aggaggagag aaagatcctg cggtgattga ggagtatatc      2160
     gaacgatatc gtgtgaccac catgcacttt gttccgtcga tgttatctac tttcttggat      2220
     tatatggaac aatataattc gaaaagggat gaatcgtctt taaatcaggt ttttactagt      2280
     ggagaagcat taaatactga acaggttcgc cggtttaagg gggtatttta cgatgttcag      2340
     caaacaaagt taattaactt gtatggccct accgaagcga ctgtggatgt gacttattat      2400
     gattgtgatt tagaaaaaga acctatgctt attccaattg gtcgtccaat tgataataca      2460
     gagttgtatg tgttggatca atatcaacag gtggtaccga ttggtgtggc gggggaactt      2520
     taccttggag gagtaggctt ggcacgtggc tacttcaatc gaccagagtt aactactgaa      2580
     cgttttattc cgcatccctt taaggaaggg gaacgattat atcgaacggg tgacctggtg      2640
     agatatatga atgatcgtaa cttggagtat attggaagaa tagataacca agtcaaaatc      2700
     agaggattcc gaattgaact gggagaaatc gaagcagctt tacatgatca ctcatctgta      2760
     aaagaggctg tcgtgttggt gaaggaagat cgaccaggag ataagcagtt agtagcttat      2820
     gtagtgggtg aaggggatac tggagagtgg cgtgaatatc tgaagaagca attgccaaat      2880
     tatatggttc cggcatactt tttccaagtt gaatcgatgc cactcactcc aaatggtaag      2940
     gtggatcgga aagctttact ggaattggag gcacagttca taagtgaaga tattacttca      3000
     tcaagaacac cagtggagga gctcatcgtt tctgtatgga gtaaagtatt aggtataaga      3060
     aatattagtg ttcaggattc tttttttgaa atcggtggtc actcgctact agctactcaa      3120
     gtagtgtcac gcttacaaga aatctttcaa atcgaattac cggtacgcga actatttgag      3180
     tatgcaacgg tggagtcact ggcaaagcga ttagatcagc tacgtaaagg agatagaaaa      3240
     cgagatattc cgccactaat gccgatggaa cgaggggaaa ctattccact atcttatgcc      3300
     caacagcgct tatggtttat cgatcaattt acacctaata gtgcacttta caatatgcca      3360
     atagtatgcc gccttacagg gagttggctg cctgaggcat tggaaacggg atggaatcag      3420
     ctaatagagc gtcatgaatc attgcggacg gtctttcatg aagtgaacgg tcaacccgta      3480
     cagcaaattg aaccgtatgc ttttcgatta attccgaaaa cggatttaac tatgctttct      3540
     ccagaaggcc gagaagaaga agttaaacgt ttgattcaac aagaaacaga aatgccattt      3600
     gatttaggtg agggtccact gatcaggaca agtattttgc aagtgggaga ggaagaatgg      3660
     attctccttt gtactctaca tcatatcatt tcagatggat ggtcaatgga agtcctactt      3720
     gaagaatgga tggcattcta tgagaaagct acggatggaa agatagcaga acttgaacca      3780
     ttaccggttc agtatgccga cttcgctcag tggcaaaaag gatggttgaa ggcggaagtg      3840
     cttgatcaac aactccaata ttggaaggaa gaattgtctg gggagcttcc tgtactccaa      3900
     cttcctatgg atcgcccgcg tcccgcaata caaactcatg acgggtcgac atacactctg      3960
     gttctgccaa gcgcgctaca tgacaaattg aacgaattta gtctccaaga aggggcaaca      4020
     ctcttcatga cgctgttggc tgcatatcaa agttttctat cacgttatac gggtcaagaa      4080
     gatattctgg tcggaagtcc aattgctaat cgaaattata gagaaattga aggacttatt      4140
     ggtttcttcg tcaacacctt ggtatatcgg gctaatctaa gtggtagacc gacatttcag      4200
     gatgttctgt ctcaggttcg tcaaaaagca ttgaaggcgt atgagtatca agatatccct      4260
     tttgaaaaaa ttgtggaagt tgtacaacca gagcggagta caagtcattc gccaatcttc      4320
     cagactatgt tcatcttgca aaatttgaaa caagagttcc cggtgttatc tggtagaagt      4380
     attgaaatga tagaaagcca tagtccaatc gcaaagtttg atttaagtgt aatggtagct      4440
     gagacggaag agggagtacg ttttactttt gaatacaata aggatttatt caatgctaca      4500
     actattgaaa ggatggcagg gcactttgag aaatggctac acgaagtttc ccatcacccg      4560
     aaaaatccgt tgcatagtct gagcatgcta tcggaacctg agcgtacttt gttattagaa      4620
     acatggaatg acactgtaat ggaaatgccc ccacagggtc ttatttgcga cagatttgag      4680
     gaacaagtag caaagcgtcc tgaagcgatt gcggtagttg atcaaacaaa agattggact      4740
     tacggtgaac tggatgcaca agcaaatcag ttggcaaatg ttttacagcg aaaaggagtt      4800
     gctccagagt cagtcgtggg agtttatctt ccgaggtcgg ctgagctcat ggtaagttta      4860
     ctaggcatat taaaagctgg tggagcttat gtcgttttag atccgttgta tccaaaatca      4920
     aggttagaat acatgattga agatgcagga attcaatttg tagtgacggc ggaaggacaa      4980
     gaaggccttt tcgaacaggt cgaaatggtg aggttagaag agttaacagt ggaaagcgta      5040
     atagcaccta cacggcagat aaatccagag aacttagctt acattgtcta tacctctggt      5100
     tctacaggaa agccaaaggg tgtcatgatt gaatatcgat cattaatgaa tatggtttct      5160
     tggcatcatg aagtttatcg tattacagca gaggatcgtg cgactcagat tgcagggatt      5220
     gcttttgatt cggctgtcca ggagatttgg ccgtatctaa ctgctggtgc agcactctac      5280
     ttgtcaacag aggaactgag aattaatcca gaagcactaa gagactggct cattgattcg      5340
     cgaataacag ctagttttgc acctacgcct attctggaaa gactcttgaa attatcttgg      5400
     ccagataaaa cggatcttcg ttttatcatt accggcgggg atcaattaac gcagtatcca      5460
     tctaacgata ttccttttgc ggtaatcaat cagtatggtc catcggaaaa taccgttgtt      5520
     accacggatt gttatgtacc tgtaggagtg acaacaggta cgccatcgat tggtcgaccg      5580
     attgcgaata cagaagttta tgtgttagat tctcatcttc agctagtacc aagtggtgtg      5640
     attggagatc tctatattgg agggaagagt cttgctcgtg gatatgctaa tcgtccggac      5700
     cttacaaagg aaaaatttat ttcgcatcca ttcaagtcag gagaacgtct ctattacacc      5760
     ggagacaaag caagttatct ttctgatggt gctctccagt tccatggtcg tatagatgac      5820
     caagtgaaaa ttcgtggttt ccggattgaa ttgggagaaa tagaagcagt cttgcaggca      5880
     cattcttctg tgaaagaagc ggttgtattg gtacgagagg atgatccagg cgacaagaga      5940
     ttagtagctt atgtagttgg tgaaggaagt gtccaagaat ggcgagagca tctacaaaca      6000
     catttaccaa attatatggt cccaacaaac tttattgaga tggaattttt accacttaca      6060
     ccgaatggaa aacttgattt aaaggcattg ccaataccta gcaaattatc tacggaaaat      6120
     accgttcacg cacgaactcc gctagaagaa cttatcgctt cagtgtggag tcaagtgctg      6180
     ggaatagaaa atataggtgt tcaggattct ttctttgaac ttggtggtca ttctctactt      6240
     gctacacaag tggtctcacg cttgcaagaa gtctttcaaa tcaaattacc ggtacgtgaa      6300
     ctgttcgaat attcaacggt cgaggcactg gcgaagcgat tagatcagtt acgtaaggga      6360
     ggcaaaaaac gagaaattcc accattgatg ccgatggaac gaggaaatgc cattccactt      6420
     tcttatgctc aacagcgctt atggtttatc gatcaattta cacctaatag tgcactttat      6480
     aatatgccga tggtatgccg tcttacagga aattggttac tagaagcatt ggaggtggga      6540
     tggaatcagt tgatagagcg tcatgaatca ttgcggacag tatttcatga agtggacggt      6600
     catcctgtgc agaagattca accgtatact ttccgttccc ttccacaaat tgacttaact      6660
     aagatttctc cagaagagag agaaagagaa gtggagcaat ggattcaaac tgaagtcgaa      6720
     tccccatttg acttagagca agggccattg ttccgtggac aaatcgtgaa aatttcagaa      6780
     gaagaatggg ttcttctgtg taatatgcat catattatct cggatggatg gtcgatggaa      6840
     atcttgctcc aagaatggat ggcattttat gaggaggcga ttggtgaaaa accagcagac      6900
     cttgcaccac taccagttca atatgccgat tttgctcagt ggcaaagaga atggttgata      6960
     gatgaagtac taaaccaacc gcttgcatat tggaaggaag aactgtctgg tgagttacca      7020
     gtcttaatgt tgccgatgga tcgtccccgt cctccggtgc aaacccacca tggattaact      7080
     cataatgtgt tgttgtcacg ctcattactg gataaattaa acgaacttag tcgtcaagaa      7140
     ggggccacgc ttttcatgac cttattggca tcgtatcaaa gtttccttgc ccgttataca      7200
     ggacaatcag atattcttgt tggaagccca attgcgaatc gaaattatcg agaaattgaa      7260
     gggttgattg gtttctttgt caacacgttg gtttatcgag ctgatttaag tggcgcaccg      7320
     gcatttcaag agttgttgtc tcaagtgcgg ataaaagcat tgaaggcata tgagtaccaa      7380
     gatgttccgt ttgagaaaat tgtggaggtt atccaacctg aacgaagtac aagttattct      7440
     ccgattttcc aaaccatgtt tactttgcaa aatacgggac aagagctacc aaagctacat      7500
     ggacgaagta tagaagtaat ggacagccac gcttcaatcg ccaaatttga tttaagttta      7560
     actgccgcag aagtggaaga gggcttattg cttacttttg tttataggac tgatttattt      7620
     gacagtttaa ctattgaatc catagcagaa aattttggga actggttgaa tttaatcgtg      7680
     gaacaacctg ataaatcatt agctaagttg ccgatactgt caggattaca gcaaaaacag      7740
     ttagaagagt ggaataataa tgctgtagca tatccacagg aatttgggat tcatcagctg      7800
     tatgaagagc aagtaaatcg tacacctgac gcggtggcag tggtagatga aaaacagcag      7860
     ttaacctatc gagagctgaa tgaaaaagca aaccaattgg cacattatct ccagaaatgt      7920
     gggattggga gcgagtcatt ggttggtctc tgcttccagc gttcagctga gatgattgtc      7980
     ggtctcatgg ggatcttgaa agctggggca gcctatgttc cattggatcc atcgtatcca      8040
     gaaagtcgcc tacgatatat tctggaggac acagggattc aagtattggt cacgaatgaa      8100
     gcattagaag gttggataac tgaagaaatc aaaacagttt gtttggatcg ggataaagcg      8160
     atgatttcgc gagaaagcac cctttcacca atatgtgaag tgacaggaga aaacttggcg      8220
     tatgtaatct atacttcggg atcaacaggg aatccgaagg gagttatggt agagcatcac      8280
     aatgtgattc gtttatttaa atcgacggaa tgttggtatc agtttgatga aaaagatact      8340
     tggacgcttt tccattctta tgcgtttgac ttctcggtat gggagatttg gggggcatta      8400
     ctccatggcg gaagattgat tgttgttcct tactggatta gtcgatcgcc caaggatttc      8460
     tatcaactgt tagtaaagga aaaggttacg gttcttaatc agacaccatc cgcatttcga      8520
     caattgatac aagtgtgtga acaagaagat gagaagaaag acttgcatct gcgctatgtc      8580
     atatttggtg gggaagcact cgatcctacc agcttggtac catggtttca aaggtatgga      8640
     gggcaggaac cacagttaat taatatgtat ggaattacag aaactaccgt tcatgttacg      8700
     tattatccaa ttactcaaga tgatgtgcag catgcttcaa gaagtaatat aggaaaacag      8760
     attccagatt tagaagtgta tgtactagac gcttgtcaac aacctgtgcc tattggcgta      8820
     gctggcgaac tatttattgg tggagcagga cttgcacgtg gatatttaaa cagatccgaa      8880
     ttgactgcag agcgtttcat tcctcatcca ttcagtagtg acccaggagc gcgattatat      8940
     cggacaggag acttagcgag atacttacct gatggaaatc tggattatct tgggcggatt      9000
     gatcaccagg tgaaaatccg tggtttccga attgagctcg gagaaattga atctgcttta      9060
     aacgcacatg tctccataaa agaggctgtt gtaattgttc gagaagatca gccgggtgat      9120
     aaacggttgg tggcatatgt cgtgggtgat gggaatgtag gtgagtggag agattatctc      9180
     aaggcggaac taccaagcca tatggttcct tcaggatttg tgatgatgga agccattcca      9240
     ctaactgcta acggaaaagt tgatcgtaag gccttacctg taccagagga gaggaaaatc      9300
     gaaagtgaat gtgttgccac gcggaatggt aacgaagaaa cactggccac catttggaag      9360
     caagtattag ggattaaaaa ggtgggaatc catgataatt tctttgaaat tggtggagac      9420
     tcgattctca gcattcagat tgtctctcgt gcgaagcaag caggtttgca attgacgcca      9480
     aagcaaatgt ttgaacacca aacgattgct gagttggcgc aagtagtcaa tgaagaacgg      9540
     ggtgtacaag cagagcaggg agttataact ggagaactga tccttacacc aattcagcaa      9600
     tggttttttg cacaagatca tccaaaccca caccattgga atcaatccat gttttttaga      9660
     acaaaagagc gactggatat agtattactg gagaaagctg tgcgtaccct tctaatccat      9720
     catgatgcct tgcgtttaag atatgaacgg ttaccgaatg gagcttggaa acagtggaac      9780
     gaagggatcg aagaacaatc gacgctgacc gttatttcat tagacgaagt gccgcaagca      9840
     gaatggcatc aagtgattca agcggagatt gacactgcac aagcaagctt gcacttacac      9900
     gcaggaccgc taatgagaat ggtgtatttt gatgaaggtg agaaaagagc cggccgatta      9960
     ttctgggtga ttcatcactt agcagtggat ggtgtttctt ggcggatttt actggaggat     10020
     ctgcaaacgg cgtataatca agcgagccag gatcagatga tccaattacc tacaaagagt     10080
     acatccttta aagcgtggtc ggagaaattg catcattacg ctgaagctgg gattgtgcaa     10140
     gaagtgcgtg attactggga gcagcaatcc gaacaagaag tggctatgct accagtggat     10200
     accaccctcg aagttccagc caacacagga accgaggaga ttaccgtggt gctggatgag     10260
     aaagagaccc gtacgttatt gaaagagatt tcaagcactc atcgtgtcca aatcaatgaa     10320
     gtactattga cagcattggt acaggctacg gcagtatgga caggtcatcc ggcgctgacc     10380
     gtggatttgg aggggcatgg tcgggaagag attatcgaag acgttgacct atctagaacc     10440
     gtggggtggt ttacaagtat ttatcctgtt cacttaaata ttaccggtgc tgacacgcca     10500
     attgcagcat taaaagcagt taaagaacaa gtgcgtaaaa ttcctaataa gggtgttgac     10560
     catggaattt tgcggtatct gaacacaaca atatgcgagc aatgggggtc tcaacataca     10620
     ccgtctatta gttttaacta tcttggacaa tttgaccaaa tgttttctga cgatgcaata     10680
     cttattccag agaacggatt taagcgctta gatcatgctt ctggttccaa gcgatcgcat     10740
     ttaattgatg taattggaat ggtaacggat gggaaacttc agttcacttg ggtatacaat     10800
     gtaggacaat atgcgaaatc aacgattcaa agtattgcag agaatatgct ccatcaacta     10860
     agtaaattga ttcaatctgc gggtggagaa tctgcactga ccgtttcaga ttttgtgatg     10920
     gctaatcttg accaagccag tttgacaaaa gtattaacca agatgaatcg tggaaataat     10980
     tatccgatta ccgatttata tccactatcg cctttgcaag aaggtatgat tttccataca     11040
     ttgcatgacc aaggggagga acatgtagcg ccttatatag tgcaattaag tttcatgatt     11100
     agaggagaat tggatattgc tactttcgaa caggcgtgga aatcggtaat tcagcggcat     11160
     gaaattttcc gctcagcttt cctttgggat gaagttgaag agcctttaca agtggtgtat     11220
     gagagtgttc catttaaggt gaatgtagaa gattggcgta cgctgactgc tgaagaaaaa     11280
     gaagagaaaa gaaaagcctt tttggcattg gatcgaaaac aagcctttct ttttgataaa     11340
     gcgccattga tgcgggtgac tgtcattcaa gaaggtgagg aagaatatcg gattgtttgg     11400
     acacatcacc atattctgtt ggatggatgg agcctaccac tggtctttaa cgaattgctt     11460
     acagtgtacc agaagagaat gaatggagaa gccgtgcatt tacctaattc atcgccatac     11520
     aagaaatata ttcaatggct aagagaacag aatcaggagc aggcggagca attctggaga     11580
     gagaaactta aaggttttac agctccaacc ctgctgggct tagaaagtaa agagcaagaa     11640
     aaaggttaca cagagaaggt aacttattta tcagaagagc aaacccaagc gttacaaaac     11700
     tgggcgaagc gcaataggct cactttgaat acagtaattc aaggtgcgtg ggcgtatctc     11760
     atgagccggt atagtggaga agatgaaatt gtctatggtg taactagctc aggacgccct     11820
     acggagatta ttgatgttga aaacattgta ggtcctttta ttaccacatc accgacgcga     11880
     attcagttga tagataatat aaaagtaatg gattggttgc tgaagataca agaggaagag     11940
     atagaaagaa gacaatatga atatgcttct ttgacagaga ttcaaggatg gagtgaaatt     12000
     cctagaggaa ccccgctgtt ccatagcttg tatgtgtttg aaaactaccc agtgaaagag     12060
     gggtcctcag gaaatctaga aattggtgag ttggaaggag tagagcaaac tcattatcca     12120
     ttaggattga cagttgttcc agaaagccag ttgttgttaa agttgaagta tgatcgtagc     12180
     aagtttaatg gcctcaccat tgaacggatg ctgggccatt taagccaggt gttaaagcaa     12240
     atgatcgaga acgttgatca aactctgtcg gagctggtgt atgttacgga aatagaacag     12300
     aaacaactgc tggaagaatg gaatgataat gcagcagcgt atccacgtga aagtgtgatc     12360
     cacaaacttt ttgaagatca agtggatcgt acacctgatg cggtggcagt ggtggatgaa     12420
     aatcagcggt tgacgtatcg agagctgaat gagaaagcaa accaattggc ccattatctt     12480
     cagaaaatgg ggattggaac ggagtcattg gtcgggcttt gtttccaacg ttcagttgag     12540
     atgattgtcg gtctcatggg aatcttgaaa gctggatcag cctatgttcc gctggatcca     12600
     tcgtatccag aaagtcacct acgatatatt ctggaggaca caggaattca aatattggtt     12660
     acgaacgaag tatcacaagg ttggatgcct gaagaagttg aaacagtttg tttggaccga     12720
     gatcaagcaa tgatttcgca agaaaacact ctttcaccaa tatgtaaagt aacaggagaa     12780
     aacttggcgt atgttatcta cacttcaggt tcgaccggga atccaaaagg ggttatggtg     12840
     cagcatcatt cggtattaaa tctatcctat ggtttacaga aagaggtttt ttcacatcgg     12900
     gcacatgata acatgcgcgt tggtctaaat gcctcaatcg cctttgattc atccgttaaa     12960
     caattacaaa tgcttttgta tggttctagt ttgtatatta tttcaacaga agttcgcagt     13020
     gatcctcaac agtttatatc ttatattcgg gagaataagt tggaaatgtt cgatataaca     13080
     ccttcactac tccaattact catagatgag gggttgttag aaacaaacga tagtgttcat     13140
     gttccaagca aggtactggt cggtggagaa gcgattatgc catcactgtg ggaacaacta     13200
     gtagagaatg accatatcca tttttataat gtatatggtc ctacggaatg tacggttgat     13260
     gcgacatgct atcgtatcaa aaaagatagt aagagagtaa ccattgggcg tccgttgcca     13320
     aatgttcaag cctatgtatt ggatgagaag ttgttacctg ttccagttgg tgtaacgggt     13380
     gaactttata tcggtggagc aggcctagcg agaggatact tgaatcgtcc agagttaacg     13440
     ttagaacgtt ttattccaca tccatttaat gaaggagaac ggttataccg gacgggagat     13500
     ctagtccgtt atttagctga tggccatttg gattatctgg gaagaatcga taatcaagtg     13560
     aaaattcgag gattccggat tgagcttgga gagattgaag cgaatttaga aagtcatcca     13620
     tcggtgaaag aggcggtagt cttgataaga gaggaccaac caggagatca gagattggtt     13680
     gcttatgtgg tgggtgaagg aagtatgcat gaatggcgtg agcatctcaa gagacaagta     13740
     ccgaatcata tgattcctgc acactttatt gaggtggatg cgattccgct tacaacaaat     13800
     gggaaggttg atcgaaaggc actgaacagc ttaacgattc aaagagaaaa taccttttct     13860
     acaccaatta tcccacggga tgaaatcgag tatcagctga ttacaatctg gcaggatttg     13920
     ctacagttag aagatatcca tgtaaacgat gatttcttca atataggagg tcactctctc     13980
     cttgtaatca aattgatttc aaaggtcaga gagaaatttg gaaaagagat taaggtgccc     14040
     gcactaatta agaatccgac agtggaagga atcgcttgtc tcatccgtga gaatcatcgt     14100
     atggaagaat cattatcggt tctggttcca ttacaagaat cagagaaaag acctttcttc     14160
     tgtgttcacc cgtttatggg taatgtactc tgttacattc agctagcaag gttactcaag     14220
     gatcactgct cattttatgg tttacagaat cctctcgtag agaaagaagg aatgaacggg     14280
     ttgattttat cggaagtagt tcaactctac atcgaggaaa tgaagcgggc tcagccagag     14340
     gggccatatc gtctgggagg atggtctctg ggtggtgcca ttgcctatga aatcgcaact     14400
     atgctacgga accagggaga agaagttgag gtgttggtac tattggatac caaggtgcct     14460
     tcagaacggg attacaagac agaggatgac atgctatctt atatattgga gcatttcatc     14520
     catatagagc tagtggatca ggaagaagag cttgttcatc aacaggacat gcttgttgag     14580
     caattaattg tggaaggagt gctcccgcct gatgcaaatc ttacgaattt gaagcaactt     14640
     atcaatgctc acaggaaatg tctgaattta atggcagagc atgatttaac accatatttt     14700
     ggggaagtca tttactttag tgctgaggaa ggtaaagaat tgtttacgga ttggaagcct     14760
     ttattaaaag gaagagtgaa tatgtattcg gtccctggat cacacgaaga aatagtagct     14820
     tcccccgcag ttgaaaagct agctaagtat ctactaaatg aattagaagg aataaaagag     14880
     acatcccttt cgctaacgga aaagtag                                         14907
//

If you have problems or comments...

PBIL Back to PBIL home page