(data stored in ACNUC9435 zone)

EMBL: CP000904.PE162

CP000904.PE162       Location/Qualifiers
FT   CDS_pept        complement(235095..241565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5618"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; phosphopantetheine-binding; KEGG: bce:BC2453
FT                   peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5618"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46586"
FT                   /db_xref="GOA:A9VUL5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL5"
FT                   /protein_id="ABY46586.1"
FT                   /translation="MGDVIDIYGLSPLQKGILFHTLYDQDDEHSFSYIVQVGFLLGGQL
FT                   DVATFEKAWEYVIHRHEVLRSVFVWEEVEKPLQAVYQRLPFTIHQEDWSAHSHEEREKK
FT                   LHQFLTADRRKGFLLDEAPVMRVTAIKEAEEETRIIWTHHHILLDGWSVSLVFSEVMEV
FT                   YLKMIKGELLNFPKPLPYKKYIQWINKQDQSQAEEFWTEELKGFYAPTPLAMERKDQEQ
FT                   EKGYGECVYQVSEELTENLQEWIRNSRLTLNTLVQGAWAYLMSRYSGESDIVFGVTSSG
FT                   RPTDLIGAENMVGLFINTLPTRIRLTNDTLVVDWLRKIQMKEMERRQYEYNSLVDIQGW
FT                   SEVPRNSSLFHTLYVFENYPIQGERNDDLRLLDVKSAEQTNYPLTLIVMPGKEITLKLM
FT                   YDRSYFNEETINRIQGHLLQTLIQMTKSLDSKLSEITHLTMEEQTQLLEEWNNTQVKYS
FT                   AEGMIHTAFEEQVKKTPGAIAAIYENEQITYRELDERANQLAHYLQKRSVGPESLVGVY
FT                   MERSLQMMIALLGILKSGGAYVPLDPTYPESRLRYILEDAGIEVLVTEENSENLYISED
FT                   VETICMNKDYTAIKKEESIPCISGVTGRSLAYVMYTSGSTGNPKGVMIEHHSVINYLEW
FT                   MQHKYPLSEKDVVLQKTPFSFDVSVWELFWGIHVGASISFLPPGGEKDPTIIAEVIEKH
FT                   QVTIVQFVPSMLSVFLDHLNHIELNMNCSSMRHVFSGGEELSSGLVRRFQQQWNHSGQV
FT                   KLTNFYGPTEATIYVNAFDIQPNQEFVSIGQPIQNTQLYVLDQNQRLQSIGIEGELYIG
FT                   GAGLARGYLNRPNLTAEKFVSHPFRLGEQLYRTGDSVRYLTDGNLEFIGRMDHQVKMRG
FT                   FRIELGEIEATLEKYSFIKEAVVLVREDRPGDQRLVAYVISDGNTQKWREYLQNQLPNH
FT                   MIPAHLVELEQFPLTPNGKIDRKALPAPDEQPMGDFNVLPRTPTEELIASVWSQVLGIE
FT                   NIGIQDSFFEQGGHSLLATQIVSRLQELFQIKIPLRELFKHDTVESLAERVDQLRKEDK
FT                   KREVPPLVPMTREESIPLSYAQKRLWFIDQLMPNNAMYNIHAACRLTGKWSIEALEAGW
FT                   NQLLERHESLRTIILEQEGEPFQQVQSHVFRHIPQTDLTDLSLEDRKREMKRLIQNEAE
FT                   ETFHFGQGPLIRTRILKVDREEWVLLCTMHHIISDGWSMGILLEEWMAFYEGALSEKPP
FT                   ELKELSIQYADFVMWQKEWQKEENLDQHLQYWKEELSGELPVLQLPMDRPRPAVQTHRG
FT                   ASQSLMVANSLQEKLKGLSLQEGSTLFMTLMAAYQSFLSRYSGQDDILVGSPIANRNVK
FT                   EVEGLIGFFANTLVYRADFSGNPTFQELLSQIRKKALKAYEYQDIPFEEVVESVKPERN
FT                   TSHSPIFQTMFTLQNTKQEFPQLSERHMELMESHTSVAKFDLSLFASETEEGLSLTFEY
FT                   NTDLFNDTTIERMASHFEHWLYQIVSHPKDLLSELNMLSKVEYKQLLEEWNETGVVDIR
FT                   ESTIHTLFEEQVEKTPEAIAVVCEDEELTYRELDERSNQLAHYLQKHGVGCESMVGICV
FT                   TRSSEMIVGLLGIMKAGGAYVPIDPAYPESRLQYILEDAHIKVLVTLEKLQQKMVIPKS
FT                   VAVICIDRDREEIEQEVTTVCTSEVTGDNLAYIIYTSGSTGNPKGVMIEHRNTVTMIHW
FT                   AHHTYSQKELAGVLASTSLSFDLSVFEVFVPLTMGGKVIVAENALHLDKLSTKGVTLVN
FT                   TVPSAAKELVRAKTIPSSVKVMNLAGEPLPYSLVQDLYERSTIEKVYNLYGPSEDTTYS
FT                   TYMELEKGVMHRVPPIGKPVFNTEVYVLSAEQKMVPIGVVGELYIGGSGLARGYLNRPD
FT                   LTQDRFIPHPFKEGERVYRTGDLVRYLPDGNLEYLGRIDHQVKIRGFRIELGEIEATLQ
FT                   KHALVNEVLVMVREDYPGDPRLIAYVLGDGDAHKWRDYLKDQLPNYMIPAYFVGLNAFP
FT                   LTSNGKIDRKALPAPERQEIASGYIAPRTPTEKTIVSIWHQVLGVENIGVQDSFFEIGG
FT                   HSLLATQAVSNLKEAFGIELPLHDLFTFHTVQQLAKQIDQLFYNKNQEIQNDSKENVSL
FT                   QDYIQKEAEVSNDEELLELLKQLEELSEEEAQGIFESNLVEEGVKK"
     atgggagacg ttatagatat atatggatta tcacctttgc aaaaaggaat attgtttcat        60
     actttatacg atcaagatga tgaacattct ttttcctaca ttgtacaagt aggcttcttg       120
     ctcggggggc aattggatgt tgctactttt gaaaaggctt gggaatatgt tattcatcga       180
     catgaagttc tacgctcagt atttgtgtgg gaggaagtag aaaaacctct gcaagcagtt       240
     taccaacgtc ttccttttac tattcatcaa gaggattgga gtgcccattc gcatgaggag       300
     agggagaaga aattacacca gtttttgact gcagatcgta gaaaaggatt tttattggat       360
     gaagcaccgg tgatgagagt cactgcgatt aaagaagcag aagaggaaac gagaatcatt       420
     tggacacatc atcatatttt gctagatggg tggagtgtgt cattggtctt tagtgaagtg       480
     atggaagttt atctcaagat gataaaggga gaattgttga attttcctaa acctcttcct       540
     tataaaaaat atatccagtg gataaataaa caagatcaaa gtcaagcaga ggaattttgg       600
     acagaagaat taaaggggtt ttatgcacct acgccattag cgatggaaag aaaagatcaa       660
     gaacaggaga agggctatgg agagtgtgtt tatcaggtat ctgaggaact cactgagaat       720
     ttacaagagt ggatacgaaa tagtcgatta acattgaata cgttagtaca aggcgcatgg       780
     gcctatttga tgagtaggta tagcggtgaa agtgacatcg tatttggcgt aactagctct       840
     ggacgtccta ctgatttgat aggagcagag aatatggtag gtctatttat taacacatta       900
     cctactagaa ttcgattaac gaatgataca ttagtagtag attggcttcg taaaatacag       960
     atgaaagaaa tggaacgaag acaatatgaa tataactcgt tggttgatat tcaagggtgg      1020
     agtgaggttc cgcggaatag ctccttattt cataccttgt atgtgtttga aaattatcca      1080
     attcaaggtg agagaaatga tgatttaaga ttactagatg ttaaaagtgc ggaacaaaca      1140
     aattatcctt taacactcat tgtaatgcct ggtaaggaaa ttactttaaa gttgatgtat      1200
     gaccggagct attttaatga agaaacaata aatcgaatcc agggtcactt attgcaaaca      1260
     ttaattcaga tgacaaagag cctagattca aagctctccg aaattactca tttaacaatg      1320
     gaagagcaga cacagttact agaggaatgg aataatactc aagtaaaata ttcagctgaa      1380
     ggcatgattc atacggcatt tgaggagcaa gttaagaaaa cgccaggagc aatcgcagct      1440
     atttacgaaa atgaacaaat cacctataga gagttggatg agcgtgctaa tcagctagca      1500
     cattatttac aaaagcgtag tgtaggtcca gagtctcttg tcggagtata tatggaacgt      1560
     tcattacaaa tgatgatagc gttattaggt attctaaaat caggaggggc atatgttcca      1620
     cttgatccta cttatccaga gagtcggctt cgttatatat tagaggatgc tggaattgaa      1680
     gtactagtga cggaagaaaa ttcggaaaat ttatatatat ctgaagatgt tgaaacgatt      1740
     tgtatgaata aagattatac tgcaattaaa aaagaagaat caatcccatg tataagtggt      1800
     gtaacaggga gaagtttagc gtatgttatg tatacttcag gatctacagg taatccaaag      1860
     ggagtgatga ttgagcatca ttcagtaatc aattacctag aatggatgca acataaatat      1920
     ccactttctg aaaaggatgt ggtcttgcag aaaacaccat tttcatttga tgtatctgtt      1980
     tgggagttat tttggggtat tcatgttgga gcaagtatat ctttcttgcc tccaggtgga      2040
     gaaaaggatc ctaccattat agctgaagtg attgaaaaac atcaggttac tattgttcaa      2100
     tttgttcctt cgatgttatc tgttttctta gatcacctca atcatattga attgaacatg      2160
     aattgttcgt ccatgcgtca tgtattttct ggtggggaag aactaagttc agggttggtt      2220
     agacgatttc aacagcaatg gaatcatagc ggacaagtaa aattaactaa tttttatgga      2280
     ccaactgaag ccactattta tgtaaatgca tttgacattc aacctaatca agaatttgtt      2340
     tctattgggc agccgataca gaacacgcaa ttatatgtat tagaccaaaa tcaacgctta      2400
     caatcaatag ggatagaggg tgagttatat attggtggtg ccggtttagc tcgtggatac      2460
     ttaaatcgtc cgaatctcac tgccgaaaaa ttcgtttcgc atccatttcg attgggagaa      2520
     caactatatc gaacaggaga ttcagtaaga tatctaactg atgggaattt agaatttata      2580
     gggagaatgg accatcaagt aaaaatgcgt ggttttcgga ttgaacttgg agaaattgaa      2640
     gcgactttag aaaagtattc gtttattaaa gaggctgtcg tattagttag ggaagatcgc      2700
     ccgggtgatc agcgattggt tgcatatgta ataagcgacg gaaatactca aaagtggcga      2760
     gagtatctac aaaatcaatt gccgaatcac atgattccag cgcaccttgt agagttagaa      2820
     cagtttccgc ttactccgaa tggaaaaatt gatcgaaaag ctttgccagc acctgatgag      2880
     caacctatgg gagattttaa tgttctacct cggacaccaa cggaagagct tattgcctct      2940
     gtttggagtc aagtgttagg aatagaaaat atcggtattc aggattcctt ctttgaacag      3000
     ggtggacact cactgctcgc tactcaaatc gtctctcgat tacaagaatt gttccagatt      3060
     aaaatcccgc tacgtgaact gttcaagcac gatacagtgg aatcattagc ggaacgagta      3120
     gatcagttgc gcaaagaaga taaaaagcga gaggttccac cccttgtacc tatgacacga      3180
     gaagaatcta ttccactttc ctatgcacag aaacgcctat ggtttattga ccaattaatg      3240
     ccaaataatg cgatgtacaa tattcatgca gcgtgtcgct taacaggaaa gtggtcaatt      3300
     gaagcattgg aggccggatg gaatcagttg ttggaacgtc atgaatcatt acggacgata      3360
     attctagaac aagagggtga accttttcaa caggttcaat ctcatgtatt cagacatatc      3420
     cctcaaacag atctaacaga cctttctttg gaagatagga aaagggaaat gaaacggctc      3480
     attcaaaacg aagcggagga aacatttcat tttgggcaag gtcctctgat tcgaacacga      3540
     atattgaaag tggacaggga agaatgggtt ctcctttgta cgatgcatca tattatttca      3600
     gatgggtggt caatgggaat cttacttgaa gaatggatgg ctttttatga aggagcacta      3660
     agcgaaaaac cgccggaatt aaaggagtta tctattcaat atgcagactt tgtcatgtgg      3720
     cagaaggaat ggcaaaaaga agagaatttg gatcagcacc tccaatattg gaaggaagaa      3780
     ttgtctgggg agctaccggt tttacaatta ccgatggatc gtcctcgacc tgcggttcaa      3840
     acccaccgtg gtgcgagtca gtccttaatg gtggcgaatt ccctacagga aaagctcaaa      3900
     ggtttaagtc tgcaagaagg atccacttta tttatgacat tgatggcagc gtatcaaagc      3960
     ttcctttctc gttattcagg acaagacgac atcttggttg ggagcccaat tgcaaatcga      4020
     aatgttaaag aggttgaagg attaataggt ttctttgcaa atacgttggt ttatcgagct      4080
     gatttcagtg gaaatccgac gttccaagaa cttttgtcgc agatacgaaa aaaagcacta      4140
     aaagcatacg agtatcagga cattccattt gaggaagtgg tagaatctgt aaaaccggaa      4200
     cgaaatacaa gtcattcacc gatatttcaa accatgttta ctttacagaa tacgaaacaa      4260
     gagtttcctc agctatctga aagacacatg gaactcatgg aaagtcatac ttctgtggcg      4320
     aaatttgatt tgagtttatt tgcttctgag acggaagaag gattatcgct aacctttgaa      4380
     tataatactg atttgtttaa tgatacaacc attgaacgta tggcaagtca ttttgaacat      4440
     tggttatatc aaattgtctc tcatccaaaa gatttattat ctgaactgaa tatgttatca      4500
     aaagtggaat ataagcaact actagaggaa tggaatgaaa caggtgttgt agatatacga      4560
     gaaagcacaa ttcatacatt atttgaagaa caagtggaaa aaacaccaga agcaattgca      4620
     gtagtgtgcg aagatgaaga actaacatat cgagagttgg acgaacgctc gaatcaactg      4680
     gcacattatc tacagaagca tggtgtagga tgcgaatcaa tggttgggat ttgcgttaca      4740
     cgttcatccg agatgattgt cggcctctta ggaattatga aggcaggagg agcatatgtc      4800
     ccaattgatc cagcgtatcc ggaaagtcga ctgcaatata ttttagagga tgctcatata      4860
     aaggtattgg tgacactgga aaagttacaa caaaaaatgg ttatacctaa atccgttgcc      4920
     gtgatttgta ttgatcgtga tcgagaagaa atagaacaag aagtaactac agtgtgtacg      4980
     agtgaagtga cgggcgataa tttagcttat attatctata cttcaggttc cactggaaat      5040
     ccaaaggggg taatgattga gcacaggaat acagtaacaa tgattcattg ggcgcatcac      5100
     acatattccc aaaaggaatt agcgggagta ttagcttcaa cttcgctatc ctttgatcta      5160
     tccgtttttg aagtgtttgt tcccttaacg atgggtggta aggtgattgt cgctgaaaat      5220
     gctctacatc tagacaagtt gtctaccaag ggtgtgactt tggtcaatac tgtgccatcg      5280
     gcagcgaagg aactggttcg agcaaaaaca attccttcat cggtaaaggt gatgaatttg      5340
     gctggagaac cattaccata ttcacttgtt caagatttat acgagagaag tacgattgag      5400
     aaggtgtaca acctatatgg accgtccgaa gatactacgt attccacata tatggaatta      5460
     gaaaagggtg tcatgcatag ggtaccacca attggtaaac cagtcttcaa tacagaagta      5520
     tatgtactga gtgctgaaca aaaaatggtt ccaattggtg tagttggtga gctttacatt      5580
     ggtggatcag gattagcacg tggatactta aaccgtcctg acttaacgca agatcgtttt      5640
     ataccgcatc cgtttaaaga aggagagcga gtataccgga ctggagacct agtaaggtat      5700
     ctgccagatg gaaatttgga gtatcttggc cgaatcgatc atcaggtaaa aattcgtggg      5760
     ttccggattg aactaggaga aattgaagcg acattgcaaa agcatgcatt agttaacgaa      5820
     gttcttgtga tggtgcggga agattatcct ggtgatccac gtttgattgc ctatgttctg      5880
     ggagatgggg atgctcataa gtggcgtgat tacctcaagg accagctacc aaattacatg      5940
     attccagcct attttgtcgg attgaatgca tttccactca cttcaaatgg aaagattgat      6000
     aggaaggcct taccagcacc agagagacag gagatagcga gtggttatat tgctccccgt      6060
     acacctacgg aaaaaacaat cgtttcaata tggcatcaag ttttaggtgt agaaaatatt      6120
     ggagtgcagg attcgttttt tgaaataggt gggcattcat tacttgctac acaagctgtt      6180
     tccaatctta aagaggcttt tggaatcgag ttaccattgc atgatctatt tacgtttcat      6240
     acggtgcaac aattggcaaa acagattgat caattgttct ataacaaaaa tcaagaaata      6300
     cagaatgata gtaaggagaa tgtaagtctt caagactata ttcaaaaaga agcagaagtg      6360
     agtaatgatg aagaattact tgaactactt aagcaattag aagagctatc agaggaagaa      6420
     gcacaaggaa tattcgagag taatttagtt gaggaagggg taaaaaaatg a               6471
//

If you have problems or comments...

PBIL Back to PBIL home page