(data stored in ACNUC9435 zone)

EMBL: CP000904.PE163

CP000904.PE163       Location/Qualifiers
FT   CDS_pept        complement(241568..246124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5619"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: non-ribosomal peptide synthase; amino acid
FT                   adenylation domain; PFAM: AMP-dependent synthetase and
FT                   ligase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: bce:BC2452 peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5619"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46587"
FT                   /db_xref="GOA:A9VUL6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL6"
FT                   /protein_id="ABY46587.1"
FT                   /translation="MANEECYPLSHPQRRIWYTEVIHSGKGICNLRFLFKLHRKMDYSK
FT                   LNRVVNRVISENDGLCIRLKENGHQEPEQYFIKHEEQEFEFFDFSSVEDSDLLEKWIEQ
FT                   KTKETFTLFNSDLYYFALIKLNDNECAVFGNVHHIIMDGLSIQIFTSQIAKYYYEMHNE
FT                   TEEGEIRNSYVQFLANEQTYLNSIRFQKDQKFWLEEFKTIPSVTGLKPYNTYQVSTKAS
FT                   RETFILSEHLKRKIELFSDDYKLSVYSLFVAAFSLSMCRWTSSLDIALGMAYGNRMTKT
FT                   ERELIGMMVSTVPLRMDIDPEEEVLSFIGRVSRKQSKSLRHQKYPFDLLLKQINKENNS
FT                   NVRLFGTTIDYRDRDESGDSLWIPNGEEMQDFAVHIENLTDIDSLQVHIDYRKELFSKE
FT                   EINRFFKTMLAVIENTFKNPKQKVSEIEIISEEDKRKSLVEFNNPKLDFPPQVTIHELF
FT                   EQQAMIYPNSIAVTYEKGKVTYRELNEHANQLAHYLQKKGVGPDTLVGLCVERSLEMIV
FT                   GILGILKAGGAYVPLDPTYPEQRLQYILEDAGIQLFVTQESLKELKWLPENIKSICLDR
FT                   DRDEIGQESKTLPFSDVSSQNLAYVIYTSGSTGNPKGVMIEHHNVIRLFKSTDCWYQFN
FT                   EKDTWTLFHSYAFDFSVWEIWGALLYGGKLVVVPYLISRSPKDFYQLLVEEEVSVLNQT
FT                   PSAFRQLIQVCEQEDENKNLNLRYVIFGGEALEPISLLPWFQRYGEKEPQLINMYGITE
FT                   TTVHVTYYPITQDDVRHASRSNIGKRIPDLEVYILDAYQQPVPIGVEGELYIGGAGLAR
FT                   GYLNRPELTAERFIPHPFSSDPKARLYRTGDLARYLPDGNLDYRGRIDHQVKIRGFRIE
FT                   IGEIESTINAYASIKEAVVIVREDQPGDKRLVAYVVGDGNVGAWREYLKTKLPSYMVPS
FT                   RFVTMEAIPLTANGKVDREVLPMPEEEQTNSEAVAPRNSNEKILATIWKQVLGVKKVGI
FT                   HDNFFEIGGDSILSIQIIFQASQEGLKLTPKQMFECPTIAELAQVAIETQGVQAEQGIV
FT                   TGEVPLTPIQYWFFEQEHSRPEHWNQSMLLRVKERLDVKLLEGAILNLLKHHDALRFRY
FT                   EQLPNGTWRQRNEGTDEHSVLHVVKRNKANEQAWNKVIQEEMNITQTSFNLVTGPLMRV
FT                   VYFEDTLSGNDRIFWVIHHLVVDGVSWRILLEDLQAVYNQMKQGQGVRLPAKSTSFKEW
FT                   SERLQAYSDSGISKEVQDYWNERVEKETMKIPMDYPMQETTEESIDQVTRTLGVEETHA
FT                   LLQEVPVTHKTRINEVLLAALGQAIVDFTNEQTVSIHLEGHGREEMVEGIDLSRTVGWF
FT                   TSIYPVHLNFQGTKTPIEGLKAVKDQLRQIPNRGVDYGILRYLKKELLPFYQQKPSISF
FT                   NYLGQFDQVFSKESLFMQETGFTFLDHAPDSKPSHLIDVIGMVKDKKLHFVWMYSREQF
FT                   SRLKIQAIADGMLRHLRQLINKPTTESAFTVSDFADAEDLTEESLSKVLLKLTKKRV"
     atggccaatg aagaatgtta tccgttaagt catccacaga ggagaatatg gtatacagaa        60
     gttattcatt ccggtaaagg gatatgtaat ttaaggtttt tgtttaaact tcatagaaaa       120
     atggactatt caaaattaaa tcgagttgtg aatcgtgtta ttagtgaaaa tgatggtctt       180
     tgcatcagat taaaagaaaa tgggcatcag gaacctgaac aatattttat taaacatgaa       240
     gaacaagaat ttgagttttt cgatttcagt tccgtggagg attcagattt gcttgagaaa       300
     tggatcgagc agaaaacaaa agaaacgttt acattattta attcggattt atactatttc       360
     gctttaataa aattaaacga taatgaatgt gcagtctttg ggaatgttca tcatattatc       420
     atggatggtt tatcaatcca aatatttacc agtcagattg caaaatatta ttatgagatg       480
     cataacgaga ctgaggaagg cgaaattaga aattcatatg ttcaatttct ggccaatgaa       540
     caaacatact tgaatagtat tcgctttcaa aaagatcaaa aattctggtt agaggaattt       600
     aaaacaattc catctgtgac gggattgaag ccttataata cgtaccaagt tagtaccaaa       660
     gcatcacgtg aaacgtttat attatcggag catttgaaga gaaagataga gttattttct       720
     gacgattata aattaagtgt atattctctt tttgttgctg ctttctcatt gtctatgtgt       780
     cggtggacct catcgcttga tattgcatta ggaatggctt atggcaatcg tatgactaaa       840
     acggaacggg aattaattgg aatgatggtg agtacggttc ctctaagaat ggatatcgat       900
     ccagaagaag aagtactttc atttattggt agggtgtcca gaaaacaaag taaatcatta       960
     cgacatcaga aatacccatt tgatttgtta ttaaagcaga ttaataaaga gaataacagc      1020
     aatgttagac ttttcggaac tacgattgat tatagagatc gtgatgaaag tggtgactca      1080
     ctttggattc caaatggtga agaaatgcaa gattttgcag tacatattga gaatttgact      1140
     gatatagact ctttacaagt acatattgac tatcgtaaag agctattttc taaagaagag      1200
     ataaaccgct tttttaaaac catgttagca gtaatagaaa atacatttaa aaacccaaag      1260
     caaaaggttt ctgagattga aattatttca gaagaagata aaagaaaaag tttagtagag      1320
     ttcaacaatc ctaagcttga ttttccacct caagtaacta ttcatgaatt gttcgaacag      1380
     caagcgatga tttatccaaa ttctattgca gttacgtatg aaaaaggaaa agttacttat      1440
     agggagctaa atgaacatgc aaatcagtta gctcattatc tgcaaaaaaa aggagtagga      1500
     cctgatactt tagttgggct gtgcgttgaa cgttctctag aaatgattgt aggtatttta      1560
     gggattttga aggctggtgg agcctatgtt ccacttgatc caacatatcc agagcagcga      1620
     cttcaatata ttttagagga tgctggcatt cagttattcg taacgcaaga aagtttaaaa      1680
     gaattgaaat ggttaccaga aaatattaaa tcgatttgcc tggatcgtga tagagatgag      1740
     attgggcaag aaagtaagac cttgccgttt tctgatgtaa gttctcaaaa cctagcttac      1800
     gtaatctata cttcgggatc aacagggaat ccaaagggcg ttatgataga gcatcacaat      1860
     gtcattcgtt tatttaaatc gacggattgt tggtatcagt ttaatgaaaa agacacttgg      1920
     acgctttttc attcttatgc atttgatttc tcagtatggg aaatttgggg agcattatta      1980
     tatggtggga aattagttgt tgttccgtac ttgattagtc gatcgcccaa agatttttat      2040
     caattattgg tggaggaaga agtctcagtt ctaaatcaaa caccttccgc atttcgacag      2100
     ttaatacagg tgtgtgaaca agaagatgag aataaaaact tgaatctacg ttatgtaata      2160
     tttggtgggg aagcgttaga acctattagc ttgttaccgt ggtttcaaag atatggggag      2220
     aaagaaccgc agctaattaa tatgtatgga attacagaaa ctaccgttca tgttacatat      2280
     tatccaatta ctcaagatga tgtgcggcat gcttcaagaa gtaatatcgg aaagcggatt      2340
     ccagatttag aagtgtatat actagatgct tatcaacaac ctgtacctat aggtgtagag      2400
     ggtgagcttt atattggcgg ggcagggctt gcacgtgggt atttaaatcg acctgaatta      2460
     actgcagagc gctttatacc tcatccattt agtagtgatc cgaaagcaag attatatcgg      2520
     acaggagact tagcaaggta tttgccggat gggaatctgg attatcgtgg aagaattgat      2580
     catcaggtca aaatacgtgg tttccgaatt gagattgggg agattgagtc tactataaat      2640
     gcatatgcat ctataaaaga ggctgttgta attgttagag aagatcaacc gggtgacaaa      2700
     cgattagtag catatgttgt aggagatgga aatgtaggtg cgtggcgaga gtatcttaaa      2760
     acgaaactac cgagctatat ggtcccttcg agatttgtga cgatggaagc cattccacta      2820
     acagctaacg gtaaagttga tcgtgaggtc ttacctatgc cggaggaaga gcagactaac      2880
     agtgaagctg ttgcccctcg gaatagtaac gaaaagatac tggctaccat ctggaagcaa      2940
     gtattaggtg ttaaaaaggt aggaatccat gataatttct ttgaaattgg tggcgactca      3000
     attctcagta ttcaaatcat atttcaagca agtcaagagg gattaaaact tactccaaag      3060
     caaatgtttg aatgcccaac cattgccgag ttggcacaag tggctataga aactcaggga      3120
     gtacaagcag agcagggaat tgtgacagga gaagtgcccc ttactccaat tcagtactgg      3180
     ttcttcgagc aagaacattc acgtccggag cattggaatc aatcgatgct tttaagagta      3240
     aaagagagat tggacgtgaa gttactagaa ggagcgatct taaacttact aaaacatcat      3300
     gatgctttac gtttccggta cgaacagtta ccaaatggaa cgtggaggca gagaaatgaa      3360
     gggactgatg agcattctgt acttcatgtg gtaaaacgga acaaagctaa tgaacaagcg      3420
     tggaataaag taatacaaga agagatgaac attactcaaa ctagtttcaa tttagttaca      3480
     ggtccgttaa tgagagtagt ttactttgag gacaccttgt ctggaaatga tcgaatattc      3540
     tgggtgattc atcatttagt agtagatgga gtatcgtgga gaattctatt ggaagattta      3600
     caggcggtat ataaccagat gaaacaaggt caaggagttc gcctacctgc gaaaagtaca      3660
     tcttttaaag agtggtcgga acgcctgcag gcatacagtg attcgggtat ttcaaaagaa      3720
     gtacaagatt attggaatga acgggtagaa aaagaaacga tgaaaattcc aatggactat      3780
     ccaatgcaag aaacaacaga agaatcgatt gatcaagtga cgaggacttt aggagtagaa      3840
     gaaacacatg cattgttaca agaagttcca gtgactcata agacaaggat taatgaggta      3900
     ctattggcgg cattaggaca agctatcgtc gattttacaa atgagcaaac ggtttctatt      3960
     catctagaag gacacgggag agaagagatg gttgaaggta ttgatctatc acggacagtg      4020
     ggctggttca cgagtattta tcctgttcat ctgaattttc aaggaactaa aacacctatt      4080
     gaaggattaa aggctgtaaa agatcaattg cgtcaaattc cgaatcgtgg agttgattat      4140
     ggtattttac gttacttgaa aaaagaatta cttccgtttt atcagcaaaa gccttcaata      4200
     agctttaact atttgggcca atttgatcaa gtgttttcaa aggaatcttt gtttatgcaa      4260
     gagacagggt ttacattttt agatcatgct ccagattcca agccatcgca tctaattgat      4320
     gttatcggta tggtaaaaga taagaagtta cattttgttt ggatgtatag tagagaacag      4380
     ttttctagat taaaaattca agcgatagca gatggtatgt tgaggcatct tcgtcaactt      4440
     ataaataaac caacaacaga gtcagctttt acagtatcag attttgctga tgctgaggat      4500
     cttacggaag aaagcttgag caaagtatta cttaaattaa caaagaagag ggtgtaa         4557
//

If you have problems or comments...

PBIL Back to PBIL home page