(data stored in ACNUC9435 zone)

EMBL: CP000904.PE164

CP000904.PE164       Location/Qualifiers
FT   CDS_pept        complement(246139..247401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5620"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bce:BC2450 macrolide-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5620"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46588"
FT                   /db_xref="GOA:A9VUL7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL7"
FT                   /protein_id="ABY46588.1"
FT                   /translation="MKTTESKSLWGNTIYLQVFSAYSLLMLGVFIDMLAIMTIVSFEWE
FT                   VDPTMIGLIPVAYALPGIIFSSWAGVIADRFRKIPIMMFCNLMVGLLTIVLLFVQTIHW
FT                   LLLALMIRSIFTVFYYPAQQTLTRQIVSPDLLTKAVSINGIVEQGTKILGPLIGGMLLS
FT                   WFQPEFCLIIRAICCLLAALVLLPTIRLQESLSREHIEKKQQSTWTAWLQGWGYVLSNR
FT                   MILSTMIFFTIAMAVLQLVDSQFPTLFKSLFPNDKSKMGYIISIIGLGGIIGAFLTQKL
FT                   KHFQYGWVICGGIALMGIGFGGISLITLINPGASLIFAYLISFIAGIGSGLMLVSNQVI
FT                   LQIESHQEQVGRVFGIQSSLANAVLIISPAMSGPLVHFFGVIELYFYVGIGLIIIGVIG
FT                   VSLQKYIWVKHKQEPIRVNNF"
     atgaaaacta ccgaatcaaa aagtctatgg ggaaatacaa tttatttaca agttttctct        60
     gcgtattcac tgcttatgct cggagtattt attgacatgt tagccattat gaccattgtt       120
     agttttgaat gggaagtaga ccccaccatg attggattaa ttcccgttgc gtatgcactt       180
     cctgggatta tatttagttc atgggcaggc gtgattgctg atcgctttag aaaaattcca       240
     attatgatgt tttgtaatct aatggttggt ttattaacaa ttgttctttt atttgtccaa       300
     actattcatt ggcttttgtt agcattaatg attcgttcca ttttcaccgt tttttattat       360
     cctgcacagc aaacactaac acgacagatt gtttctcctg atctgcttac caaagcggta       420
     agtatcaatg ggatagttga gcaaggaacc aagatactgg gcccacttat aggaggaatg       480
     ttactgagct ggtttcagcc agagttttgt ctgattataa gggcaatatg ctgcttacta       540
     gctgctttgg ttctgttgcc cacaataagg ttacaggaat ctctgtcaag agaacatata       600
     gaaaagaaac agcaaagtac ttggactgct tggttacaag gctggggtta tgtattatcc       660
     aatcggatga tattatcaac catgattttc tttacaatag ctatggcagt attacaatta       720
     gtagactcac agttccctac tttatttaaa agcttgttcc caaatgataa gagtaaaatg       780
     ggatacatca tttctattat tggtcttggg ggaataattg gcgcattctt aactcagaaa       840
     ttaaaacatt ttcaatatgg ttgggtaata tgtggaggta ttgctttaat gggaattggc       900
     tttgggggca ttagtctgat aactctgata aatcctggtg catccctcat ttttgcctat       960
     ctgattagtt ttatagctgg tattggaagt ggacttatgc ttgtatccaa tcaagtcatt      1020
     ctacaaatag aatctcatca agaacaggtc ggaagagtat ttgggattca aagcagttta      1080
     gcaaatgcag tcctcattat ttctcctgct atgagcggtc cactggttca ctttttcgga      1140
     gtaattgaac tctattttta tgtgggtatt gggctcatca tcattggagt aattggggtt      1200
     tcactacaga aatatatatg ggttaaacat aagcaagaac ctataagagt aaataatttt      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page