(data stored in ACNUC9435 zone)

EMBL: CP000904.PE165

CP000904.PE165       Location/Qualifiers
FT   CDS_pept        247805..248512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5621"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5621"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46589"
FT                   /db_xref="GOA:A9VUL8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL8"
FT                   /protein_id="ABY46589.1"
FT                   /translation="MEKENLYKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   SHTTIMRWVHQYGPELDKRIRRHLKQTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FYLSKTRDQKAAKHFFKKALQSFHVSKPRVITVDKNPAYPIAIEQLKKEKSIPGGMLLR
FT                   QQKYLNNIVEQDHRFIKKRIRSMLGFKCFDTATSILSGVEVMHMIKKEQVDLRDQSVQN
FT                   QKEFIHQLFGLAA"
     atggaaaagg aaaatttata caaatggaaa cattatcagc ctgatattat tttgttaacg        60
     gtaagatggt acctacggta caacctcagt tttcgtgatt tagtggaaat gatggaggaa       120
     cggggcttat ccatttctca tacaacgatt atgcgttggg ttcatcagta cggtcctgaa       180
     ttggacaaac gaatccgacg tcaccttaaa caaacaaatg actcctggag agtcgatgaa       240
     acatatatca aagtaaaagg tcaatggatg tacctgtatc gtgctgttga ttcaaaagga       300
     aatacaatcg atttttacct aagcaaaaca agagatcaga aggctgcaaa gcactttttc       360
     aagaaggcct tgcagtcttt tcatgtttca aaacctcgtg ttataacagt cgataaaaat       420
     ccagcttatc ccattgcaat tgaacagttg aaaaaagaaa aaagcatacc tggtggtatg       480
     ctacttagac aacaaaagta cttgaataac atagtagaac aagatcatcg ttttataaag       540
     aagcgaattc gttctatgct agggttcaaa tgttttgaca cagctacatc cattctttct       600
     ggagtagaag tcatgcatat gattaaaaaa gaacaggttg atttacggga ccagtctgtc       660
     caaaatcaaa aagaattcat ccatcaattg tttgggcttg cggcataa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page