(data stored in ACNUC9435 zone)

EMBL: CP000904.PE166

CP000904.PE166       Location/Qualifiers
FT   CDS_pept        complement(248760..250742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5622"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: cbh:CLC_2047 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5622"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46590"
FT                   /db_xref="GOA:A9VUL9"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR021862"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL9"
FT                   /protein_id="ABY46590.1"
FT                   /translation="MIIQKTRRSFNKVIIITAACSMFSMFGTSISHTKAETHSAAPAVY
FT                   VSPQNIPASDIISIDWSPVQTAPYTYWAVHNWNAGGEAGGYAGFQQQSGFDENGKRTLH
FT                   FAIWDPISSKEAIKAEYLSPNSQAGLFGGEGTGLKVQTTYGWKDYNWYRMTMRSWQEDG
FT                   HTKFGQWMKDVTKNKWHLIAIMDFPVANVAFNHGLGMFQEDWADSGQNVREARLKNGYS
FT                   RKLVDKQWSSWNNQNISGTHDNTYQYDGGATSEYVWVKAGGNTQSTIGSGKIFTLNQPT
FT                   QPEIGKLDFDIQSIYYENEKLNVSWKLKENSTPQFKGKIEIYNNENMTGQPINVIDDIK
FT                   SYQNGISQSISLPTNAYAKIVLTDLFDQTVEKKVQIKNQSPNIFEGNEFAWSLKGIGDF
FT                   EFAKVNLNRSIEEIQIALKAGVPHNYFDSTYASIKVQNTSGKVVYNKEIYGNKQQNAEQ
FT                   VKVPVKVGDFIEFTHLEGANRATITNMEKNIQESFGNKAVYEITKEGLKKVDNIVNPKP
FT                   DTEAPTQPQGLYASNVTSNSIELKWNPSTDNVGVKEYQVLRDGQLIQTVQGTTFTDQNL
FT                   TVNKEYKYAVKAVDAAGNTSIQSDILPVKTKNQNESYEKWDPKKAYTKGDKVEHQGKIY
FT                   EAVQNHQGNGDPNWIFALALWNPLT"
     gtgattattc agaaaactag gagaagtttt aataaagtta ttataattac cgcagcatgt        60
     agcatgtttt ctatgtttgg aacgtctatt tcgcacacta aagccgaaac acattcagct       120
     gctccagcag tttatgtgag tcctcaaaat atacctgcct cagatattat tagtatagac       180
     tggtcaccag ttcagactgc accttatacg tattgggctg tacacaactg gaatgcaggt       240
     ggtgaagctg gaggatatgc tggttttcaa caacaaagtg ggtttgatga aaatggaaaa       300
     cgtactttac attttgccat atgggatcca atttcctcta aagaagcaat aaaggccgaa       360
     tacttatctc cgaattcaca agctggactc tttggaggag aaggaacagg actgaaggtt       420
     caaacaactt atggttggaa agactacaat tggtacagaa tgacaatgcg ttcatggcaa       480
     gaagatggtc atactaaatt tggacaatgg atgaaagatg taacaaagaa taaatggcat       540
     ctaattgcaa ttatggactt tccggtagct aatgtggcat ttaatcatgg attaggaatg       600
     tttcaggaag actgggcgga tagtggacag aatgttcggg aagctcgcct aaaaaatggt       660
     tatagccgaa agttagtaga taaacaatgg agttcttgga ataatcaaaa tatttctggg       720
     acgcatgata atacttatca atatgatgga ggagctactt cagaatatgt atgggtcaaa       780
     gcaggaggta atacgcagtc taccattgga tcaggaaaaa tattcacgct aaatcaacct       840
     actcaacctg aaataggaaa actagatttt gatatccaat ccatatatta tgaaaatgaa       900
     aaattaaatg tatcttggaa actaaaagaa aatagtacac cgcaatttaa ggggaaaatt       960
     gaaatttata acaatgaaaa tatgacgggc caacctatta acgtaattga tgatattaaa      1020
     tcttatcaaa atggaatcag tcaatctata tcattaccaa caaatgctta tgcaaagatt      1080
     gtattaacgg atttatttga tcaaactgtt gagaaaaagg tacaaatcaa aaatcaatct      1140
     ccaaacattt ttgaaggtaa cgaatttgca tggtcgctga aagggattgg agattttgaa      1200
     ttcgcaaaag taaatttaaa tagatcaata gaagagatac aaattgctct aaaagcaggt      1260
     gtaccacata actactttga tagtacatat gcaagtatta aagtgcaaaa cacatcaggt      1320
     aaagtggtat ataacaaaga gatttatgga aataagcaac aaaatgctga gcaggttaaa      1380
     gtgccggtaa aagtaggcga ttttattgaa tttacacatt tagaaggtgc gaaccgagct      1440
     actattacaa atatggaaaa gaacattcag gaaagctttg ggaataaagc agtttatgag      1500
     attacaaaag agggattgaa gaaagtagac aacattgtta atccgaaacc agatacagaa      1560
     gctccgacac agccacaagg attatatgca agcaacgtta cttctaacag tatagagcta      1620
     aaatggaatc cttctacaga taatgtaggt gtaaaagaat atcaggtatt acgcgatgga      1680
     caattgattc aaacggtaca aggaacgacg tttactgatc aaaatctaac agttaataag      1740
     gaatataaat atgcagtgaa ggctgtagat gcagctggaa atacatcaat tcaaagtgac      1800
     attcttccgg taaaaacaaa aaatcaaaat gaatcttatg aaaaatggga tccgaagaag      1860
     gcttatacaa agggagataa agtagaacat caagggaaaa tatatgaagc tgttcaaaac      1920
     catcaaggaa atggtgaccc gaattggata ttcgctttgg cattatggaa tccactgaca      1980
     tag                                                                    1983
//

If you have problems or comments...

PBIL Back to PBIL home page