(data stored in ACNUC9435 zone)

EMBL: CP000904.PE167

CP000904.PE167       Location/Qualifiers
FT   CDS_pept        complement(250883..253132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5623"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: bcy:Bcer98_3446 S-layer
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5623"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46591"
FT                   /db_xref="GOA:A9VUM0"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR035423"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR042279"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM0"
FT                   /protein_id="ABY46591.1"
FT                   /translation="MKRVQKQKTKNLVMITATLSMFATGVTPSLEVFAEEQAQQKKVST
FT                   TLLQNENSVNVENRVFVVPGKGDVSQLQNIERRERNFSAYEPTGLYAKPNEQIIIQVQG
FT                   NQSIQAYIGTFSFDASWREDSKIKSFTLNPGTNTIQSPNGGMIYFYNKQQGGTIQTTVT
FT                   TGGAATPLFELGKHTKQDLINMLNQYPNAHAVELKGERVLITASPARVKKYLIGSNTDP
FT                   VQLLKKMDEATRIQDKISGLSEEQVDKHYLHYVEDNHSLDYYMYAYPHRTAYVGDAIQH
FT                   VLDINKFTNDGWGPWHEAGHMRQQAPWNFKNMTEVQVNLYSLAVEKAFTSNQPFRLQQE
FT                   GAYTKAFQYLEQSNKNYDEISDAFVKLVMLWQLQLAYGEDFYPKLHQLYRDMPLNEIPQ
FT                   TDETKKQLFMISSSKVAKQNLIPFFEKWGLRPNNDTIQKVAALGYPNLTAEIWKSTDSN
FT                   PVKPDTPNFSNILEGNQFAWSLKGIGDFEFAKVNLNKSTEEMQIALKAGVPHNYFDSTY
FT                   ASIKVQNTSGKVVYNKEIYGNKQQNAEQVKVPVKVGDFIEFTHLEGANRATITNMEKNI
FT                   QETFGNKAVYEITKEGLKKVDKIVNPKPDTEAPTQPQGLYASNVTSNSVELKWNPSTDN
FT                   VGVKEYQVLRDGQLIQTVKGTTFTDQNLTVNKEYKYTVKAVDAAGNTSIQSNILPVKTK
FT                   DQNVSYEKWDPKKAYTKGDKVEHQGRVYEAVQNHQGNGDQNWIFALSLWKPITIK"
     atgaaaaggg ttcaaaaaca aaaaacaaaa aatttagtga tgataactgc cacattatct        60
     atgtttgcca ctggagtaac gccttcatta gaagtctttg cggaagaaca agcacagcaa       120
     aagaaagtat ctacaacgtt attacagaat gaaaattctg ttaatgtgga aaatcgtgta       180
     tttgtagttc caggaaaagg agatgtctcc caacttcaaa atattgaaag aagggaaaga       240
     aattttagtg catacgagcc aacagggtta tatgctaagc caaatgaaca aataataatt       300
     caggtacaag gaaatcaaag tatacaagca tatattggaa ctttctcgtt cgatgcttct       360
     tggagggaag attccaaaat taaatcattt actttaaatc caggcacaaa cacaattcaa       420
     tctccaaatg gaggaatgat ttatttttat aataaacaac aaggtggtac cattcaaaca       480
     acagtaacaa caggcggagc ggctactcct ctctttgaac ttggaaagca tacgaaacaa       540
     gatttaataa atatgctcaa tcaatatcca aatgcacatg cggtggaatt aaaaggggag       600
     cgtgtattga ttactgctag cccagctcgt gttaaaaagt atttgatagg ttctaacaca       660
     gatcctgtac aactcttaaa aaaaatggat gaggctacta gaattcaaga taaaatatct       720
     ggattatctg aagaacaagt tgataaacat tatctgcatt atgtggagga taaccattct       780
     ctggattatt atatgtatgc atatcctcac agaactgcat atgtaggaga tgcaatccaa       840
     catgtattag acattaataa atttacaaat gatggatggg gaccttggca tgaggcaggg       900
     catatgagac aacaagcacc ttggaacttt aaaaatatga cagaggtaca agtcaatctt       960
     tacagccttg ctgtggaaaa agcatttaca tctaatcaac cttttagatt gcaacaagag      1020
     ggcgcttata ctaaggcgtt tcaatactta gaacaatcta ataaaaatta tgacgagatt      1080
     agtgatgctt ttgttaaact cgttatgctt tggcaattac aactagcgta tggagaagac      1140
     ttctatccta agttgcatca gctgtataga gacatgcctt taaatgagat tccacaaact      1200
     gatgaaacga aaaaacaatt atttatgatt tcatcatcaa aggttgcaaa acaaaattta      1260
     attccgtttt ttgagaaatg gggattacgc ccaaataatg atacaatcca aaaagtagcg      1320
     gcactagggt atccaaattt aacggctgaa atttggaaaa gtacagattc taatccggtt      1380
     aaaccagata caccgaattt ttcgaatatt ttagaaggaa accagtttgc atggtcactg      1440
     aaagggattg gagattttga atttgcgaaa gtaaatttaa ataaatcaac agaagaaatg      1500
     caaattgctc taaaagcagg tgtaccacat aactactttg atagtacata tgcaagtatt      1560
     aaagtgcaaa acacatcagg taaagtggta tataacaaag agatttatgg aaataagcaa      1620
     caaaatgctg agcaggttaa agtgccggta aaagtaggtg attttatcga attcacacat      1680
     ttagaaggtg cgaaccgagc tactattaca aatatggaaa agaacattca ggaaaccttt      1740
     gggaataaag cagtctatga gattacaaaa gagggattga agaaagtaga taaaattgtt      1800
     aatccaaaac cagatacaga agctccgaca cagccacaag gattatatgc aagcaacgtt      1860
     acttctaaca gtgtagagct aaaatggaat ccttctacag ataatgtagg tgtaaaagaa      1920
     tatcaggtat tacgcgatgg acaattgatt caaacggtaa aaggaacgac gtttactgat      1980
     caaaatctaa cagttaataa ggaatataaa tacacagtaa aggctgtaga tgcagctgga      2040
     aatacatcga ttcaaagtaa cattcttccg gtaaaaacaa aagatcaaaa tgtatcttat      2100
     gaaaaatggg atccgaagaa ggcatataca aagggtgaca aagtagaaca tcaagggaga      2160
     gtgtatgaag ctgttcaaaa tcatcaagga aatggtgacc agaattggat atttgcatta      2220
     tcgttatgga aaccaattac aatcaagtaa                                       2250
//

If you have problems or comments...

PBIL Back to PBIL home page