(data stored in ACNUC9435 zone)

EMBL: CP000904.PE168

CP000904.PE168       Location/Qualifiers
FT   CDS_pept        253576..254115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5624"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; KEGG: pth:PTH_2445
FT                   site-specific recombinases"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5624"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46592"
FT                   /db_xref="GOA:A9VUM1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM1"
FT                   /protein_id="ABY46592.1"
FT                   /translation="MANIYGYIRVSTKDQNEQRQLHKMMERGVEGRRIFVDKASRRHFD
FT                   RPQYQLLRKILSTGDIVVLENETLFDSRKFREMGDMGRLMEDQFLSLLSYVADQERKKI
FT                   HQRQAEGIAIAKSQGKHLGRPPVNLSTLSKQQIKIIEKTHSKWKSGEITAVMFMEMLEL
FT                   RKNTFYKIMKEYEEGK"
     ttggctaata tttatggata tatacgtgta agtacaaaag atcaaaatga acaacgtcaa        60
     ttacataaga tgatggaacg aggggtggaa ggtcgacgta tttttgtcga caaagcaagt       120
     agacgacatt ttgatcgtcc tcagtatcaa ttattacgaa aaatattgag tacaggtgat       180
     attgttgttt tagaaaatga aacgctgttt gatagtcgta agttccgtga aatgggtgat       240
     atgggacgat taatggaaga tcaattttta tctttgttgt cttatgttgc agatcaagaa       300
     cgaaaaaaaa ttcatcagag acaagcggaa gggattgcga tagctaaatc tcaaggaaaa       360
     catttaggcc gtcctccagt gaacctttcg accttaagca aacaacaaat aaagataata       420
     gaaaaaactc attcaaaatg gaagagtggc gaaattactg ctgttatgtt tatggaaatg       480
     ttagaactaa ggaaaaacac gttttataaa ataatgaagg aatatgaaga aggaaagtag       540
//

If you have problems or comments...

PBIL Back to PBIL home page