(data stored in ACNUC9435 zone)

EMBL: CP000904.PE17

CP000904.PE17        Location/Qualifiers
FT   CDS_pept        34810..36591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5449"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46441"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV09"
FT                   /protein_id="ABY46441.1"
FT                   /translation="MNAPVIESKILEKQREYLLEQAKLRLSISATQEEVSQLADEIFYR
FT                   YQSCIGKPLFQARKVVFGELPFLEDYYDNNKEMEKDLGILFSELNTIATYLVDYFNYSQ
FT                   SEKDRILSIVRSINGVVSDLQMLTEETTPNTVYLKESFMNYDNVDSVLTPVENRSMIHT
FT                   QEGVLTLRRTNALNRSIGSKVRTIQGNGIAGTYYLSRKVQSDSEFENYQYVSSQIKNDD
FT                   PKALIDGNADTVFEFEMVNIPESYKKQSFYYDVEWAKGKEHGDLLRVKIVVQLPKSETI
FT                   NWINLNPYHAAGSPGTANVYSIRTSNDGIEYQGLFEKDQFVLNQEINKTPQSYRAEDLF
FT                   DGSENFAKTKFSGQGVWSFPSREAKYIEFVLEQPNSYKELLGQEAFYRRKKDSTSFTRI
FT                   RKQEVPSNIVDEKYGIHTINSDYEIKKVLEAVEGWRYVIGVRDIDIMSFEFAEMSEYIS
FT                   KPFLLEDGIKKVLLYANEKVPAIYKEKVSESNDWIQYFVSFDDIDWHRISPQHQQPVND
FT                   KFPAKVLSVNDNESDIENAFALYKQNLQLKELPKQVRLKIIMKRPEKTTEDEIPLLHTT
FT                   PLVEDFALKILTEQKGV"
     atgaatgccc ctgttattga atctaaaata ttagagaaac aaagagaata tcttttggag        60
     caagcgaaat tacgattaag tatttctgct acacaagaag aagtatctca attagcagat       120
     gaaatctttt acaggtatca atcttgcata ggtaagcctt tattccaggc acgtaaagtt       180
     gtgtttggag aactaccttt tcttgaggat tactatgata acaacaagga aatggagaaa       240
     gacttaggta ttttattctc agaactaaat accattgcta catacctggt agattatttt       300
     aattattctc agagtgagaa agatagaatc ttatctatcg tgcgcagtat taatggggtc       360
     gtatcagacc ttcaaatgtt aactgaagaa acaaccccta acacggttta tttaaaagaa       420
     tcgtttatga attacgataa tgtggattct gttttaactc cagtagagaa cagaagcatg       480
     attcatacac aagaaggcgt attaacactg cgtcgtacaa atgctttaaa tagaagcata       540
     ggaagtaaag ttcgaactat tcaaggtaat ggaattgcag gaacttatta tctatctcgt       600
     aaagttcaat cagattcaga gttcgaaaat taccagtatg tttcttctca aattaagaat       660
     gatgatccga aagcattaat cgatggaaac gcagatactg tatttgaatt tgaaatggta       720
     aacatcccag aaagttataa gaaacaatca ttctattacg acgttgaatg ggcaaaggga       780
     aaggaacatg gtgacttact acgtgtaaag attgttgttc aattacctaa gagcgagaca       840
     atcaactgga ttaatttaaa tccttatcat gctgcaggta gcccaggtac agctaatgta       900
     tattctattc gaacatctaa tgacggtatt gaataccaag gtcttttcga aaaagaccaa       960
     tttgtattaa accaagaaat caataaaaca cctcaaagct atcgagcaga ggatttattc      1020
     gatggtagcg aaaactttgc taaaacaaaa ttttctggcc aaggtgtttg gagcttccca      1080
     tcaagagaag caaaatacat tgaattcgta ctagaacaac caaattctta taaagaatta      1140
     ttaggacaag aagcattcta tagaagaaaa aaggattcta cttcatttac acgtattcgc      1200
     aaacaggagg tgccaagtaa tattgttgat gaaaaatacg gcatccatac tattaatagc      1260
     gactatgaga ttaaaaaggt attggaagct gttgagggtt ggcgttacgt tataggagtt      1320
     cgagacatcg acattatgag tttcgaattc gctgaaatga gtgaatatat tagcaaacca      1380
     tttctacttg aagatggtat taagaaagta cttctatatg caaatgaaaa agttcctgct      1440
     atatataaag agaaggtaag tgaatccaat gattggattc aatactttgt ttctttcgat      1500
     gatatagact ggcatagaat ttccccacaa catcagcaac cagtaaacga taagttccct      1560
     gcaaaggtgc tttcagttaa tgataacgaa tctgatattg aaaatgcgtt tgctctttac      1620
     aaacaaaacc ttcaattaaa agaacttcca aagcaagtaa ggttaaaaat cattatgaag      1680
     agaccggaga aaacaacaga agatgaaata cctcttcttc atacaacacc actcgttgaa      1740
     gacttcgctt taaaaattct tacagaacag aaaggggtgt ag                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page