(data stored in ACNUC9435 zone)

EMBL: CP000904.PE171

CP000904.PE171       Location/Qualifiers
FT   CDS_pept        complement(256480..257343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5627"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46595"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM4"
FT                   /protein_id="ABY46595.1"
FT                   /translation="MNHLAFSPRELGGKSSPFLLTIEEWRSFAHYLNRWISAPTSIDQV
FT                   RERMYLILDGKVKNNWDRLITTSIFRELVEEAIATKLNVREKCRFWDNGGHKDILILSQ
FT                   NIVAFADLISIKYYNDLNQVIFEAQNGKLTPNTKSKFINICKDLSNHAQTYYQQSQSMA
FT                   TSLSEFYSEIQKYEETVQTWSHRMSYLSLHDSNDFVVAQNTVVYLVAPVMNLVQSKEFV
FT                   FPVIRKVHRIWSAISYDLKELADNIDDIENLEEFIAALELELAFEDWKAIRDEAENFYK
FT                   NAINIS"
     atgaaccatt tagccttttc tccacgtgaa ttaggaggga aaagttctcc ttttcttctt        60
     acaatagaag aatggcgttc attcgctcat tatttgaaca gatggatctc agcaccaact       120
     agtatcgatc aagtcaggga aagaatgtat ctcatactcg acgggaaagt aaaaaataat       180
     tgggatagac tcataacaac ttctattttt cgtgaattag ttgaagaagc aattgcaact       240
     aagttaaacg ttagagaaaa atgtaggttc tgggacaatg gaggacataa agacatacta       300
     atcctttctc aaaacattgt agcctttgca gatttaatct ctattaaata ttataatgat       360
     cttaatcaag taatatttga agctcaaaat ggtaaattaa ctccaaatac taaatctaaa       420
     ttcataaata tatgtaaaga tttatctaat cacgcacaga catattatca acagtcacaa       480
     tctatggcaa catctctctc cgaattttat tcggaaattc aaaaatacga agaaacagta       540
     caaacgtggt cgcatcggat gtcatattta tcactgcatg actcaaatga tttcgttgtc       600
     gcacaaaaca cagttgtcta tttagtagct ccagtcatga atttggttca gtctaaagag       660
     ttcgtgttcc ctgttattcg aaaagtccat aggatatgga gcgctatatc ttatgattta       720
     aaagaactgg cagataatat tgatgatatc gaaaatttag aggagttcat tgctgcttta       780
     gaacttgaat tggcctttga agattggaaa gcaattcgtg atgaagctga aaacttctat       840
     aaaaacgcaa ttaacatttc ttga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page