(data stored in ACNUC9435 zone)

EMBL: CP000904.PE172

CP000904.PE172       Location/Qualifiers
FT   CDS_pept        complement(257391..259715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5628"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5628"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46596"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM5"
FT                   /protein_id="ABY46596.1"
FT                   /translation="MLAHKVDYKKLYEELLNNQHIPGTFYSSTTKTKYEIRSLFVDLGE
FT                   VYKFIEENQLAPNMISIFADVVRIPDKFNCTLKDMQLVIRTRRVEIESDGKAEIRLDYK
FT                   DGSKLAQLTIYGLELSGTLHAIPIYNQSSPSPYPIELRNKGVRLSDKDGTFTKEEITYV
FT                   VPTPQFPKLFMSVFQVACLFYESQPDIAADQLNWLKAFTAQYKDLSSLCIQSTALLTIL
FT                   TANHGENTFVPLLDKDLYRDEIAAFLAAAQQFEEQYHRYLDRNLAIADRKAAATLMLQH
FT                   EQDTLLFKETLINQAKDNLRSAQNAVESSLYQFEKQQHVVTIAKIDFEYGLKKYHYEQQ
FT                   MKMAFKMLTAVLNFAESIGSIIATGGTAAPGEIIDIINSLKEVIEAGGQLAALAQSLKE
FT                   CMEKLNELVELINKIYALAAEISKASTDMDFSEELLKKIQENEWELPKEDLTGEATWKI
FT                   FQLKIAAALEDAIKKEVEGAREYLLSLDILAVYGQTLASNQVIIIRCSQELFRLLLEKH
FT                   IHQADLARLKEYIKNLEGQESENEEMEQKLYQRYLDMKQILFVALANYKHAYKYWALRD
FT                   SDVNPNILKDVSELKVDVATLQKDCMEALKQFNPPPQPFQNRTIEITDSNALKTLKETR
FT                   EASWEINLNDSFFENEYRVRLKLMRIWLDGVDATSKVQIRITNSGHYYDDYKNKKFQFN
FT                   TEPFNRGFSYVGATIITDGTIAEEFAYDYFIPNPFTTWTIKVQDGPDLSKVTKIRMELA
FT                   GSLVANYKKHNPVLNGLMESF"
     atgttagccc ataaagtgga ttataaaaaa ctatatgaag aattgttgaa taatcagcat        60
     atcccaggaa ctttttactc aagtactacg aaaacaaaat atgaaattcg cagtttattt       120
     gttgatttgg gtgaagtata taaatttatt gaggaaaatc aactagcgcc aaatatgatt       180
     tcgatttttg cagatgttgt tcgaattcct gataaattta actgtacttt aaaagatatg       240
     caactagtca tccgaacaag acgtgtggaa attgaatcag atggaaaagc agagattcga       300
     ctagattaca aagatggaag taagctcgca caattgacga tttatggact tgagctttct       360
     ggaacgttac atgctattcc tatctacaat caaagttccc catcgccata tccaatagaa       420
     ctgagaaata aaggcgtacg tttgtccgat aaagatggta cattcaccaa agaagaaatt       480
     acgtatgtag ttcctacacc tcaattccca aaactattta tgtctgtttt ccaagtagct       540
     tgtctatttt atgaatctca gccggatatt gcagctgatc agttaaactg gttgaaagct       600
     tttacagctc aatataaaga tttaagttca ttgtgtatac aaagcactgc gttacttacc       660
     attttaactg ctaaccatgg tgagaatacg tttgttccac ttctggataa agatctttat       720
     agggatgaaa ttgctgcttt cttggcggca gcacaacagt ttgaggaaca atatcaccgt       780
     tacttagata gaaacctagc aattgcagat cgaaaagcag cagctactct tatgctccag       840
     catgaacaag atacactgtt atttaaagaa acactaatta atcaagcaaa agataatcta       900
     agaagtgctc aaaatgctgt tgaatcatct ttgtatcaat tcgaaaaaca gcaacatgtt       960
     gtaacaatag ctaaaattga tttcgagtat gggcttaaaa agtatcatta tgaacaacaa      1020
     atgaaaatgg cttttaaaat gttgaccgct gttctcaatt ttgcagaatc tataggatcg      1080
     ataattgcta caggagggac tgcagcacct ggagaaatta tcgatataat taacagttta      1140
     aaagaagtaa tagaagctgg aggtcaacta gctgcattag cgcaatcatt aaaagaatgt      1200
     atggagaaac ttaatgaatt agttgaatta attaataaaa tatatgcact agctgcagag      1260
     atatcaaaag catctacgga tatggatttc tcagaagaac tcttaaaaaa aattcaagaa      1320
     aatgagtggg aacttcctaa agaggatctg actggagagg caacgtggaa aatatttcag      1380
     ttgaaaatag ccgctgcttt agaagatgct attaagaaag aagttgaggg ggctagagag      1440
     tatctactat cattagatat tctagctgtc tatggtcaaa cacttgcttc gaatcaagtt      1500
     attatcattc gctgtagtca agagctattt cgtctgttgc tagaaaaaca tattcatcaa      1560
     gcagatcttg cgagattgaa agagtatatt aagaatcttg aagggcaaga atctgaaaac      1620
     gaagaaatgg aacaaaaatt atatcaacgc tatttagata tgaagcaaat tctatttgta      1680
     gctttagcaa attataaaca tgcttataag tattgggctc ttcgcgattc agatgtaaat      1740
     cctaatattt taaaagatgt atcagaatta aaagtggatg ttgctacatt acaaaaggac      1800
     tgtatggagg ccttaaaaca gtttaatcca ccacctcaac catttcaaaa tcgaacaata      1860
     gagattacag attctaatgc tttgaaaacc ctgaaggaga caagagaagc ttcttgggaa      1920
     atcaacctaa atgattcatt ttttgaaaac gagtaccgtg ttcgacttaa attaatgcga      1980
     atttggttag atggagttga cgctacttct aaagtacaaa tacggattac gaattcggga      2040
     cattattatg atgattataa aaataaaaag tttcaattta atacagagcc ctttaatcga      2100
     ggttttagct atgtaggtgc aacgattatt actgatggca cgatagcaga ggaatttgct      2160
     tatgattact ttattccaaa tccttttaca acttggacaa ttaaagtaca ggatgggcca      2220
     gatctttcta aggttacaaa aatccgaatg gaactagcag gatctcttgt tgctaattac      2280
     aagaaacata atcctgtttt aaatggttta atggaatctt tctaa                      2325
//

If you have problems or comments...

PBIL Back to PBIL home page