(data stored in ACNUC9435 zone)

EMBL: CP000904.PE173

CP000904.PE173       Location/Qualifiers
FT   CDS_pept        complement(259943..261004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5629"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5629"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46597"
FT                   /db_xref="GOA:A9VUM6"
FT                   /db_xref="InterPro:IPR008414"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM6"
FT                   /protein_id="ABY46597.1"
FT                   /translation="MVKRDISARDLGGKEDNPFLLKKDEWIRIQKYTGDGAYLPVNVNE
FT                   MRKALALENTAELPDFGELYTVNTSIKGHCKNWNDTTYREILDVANQIVNYSRRAEVFY
FT                   APLLDYLPDILEGDTVALEKFQKICEKLAKEAKAFSDHAETLAKTVKQFADDTTNDYKN
FT                   LINVKVKYDALYGKNSEEEIKLRAEVKKLREELEKYIEDYEDYESESWLSLLLGPVFGF
FT                   ILKGILDSTHGQMLKAKVDATRQKIEATCATIQRNVYLMSLLDKADVGTDKTQKQIEEA
FT                   LPVINKIKAIWSALHKDLLTLSTITMKDIHDDPEFADLGIELAIMQWVKVGKQADDFRI
FT                   NADVGYILDQYIA"
     atggtaaaaa gagatatttc agcaagagat cttggaggta aggaggataa tcctttttta        60
     ctaaaaaaag atgaatggat tagaattcaa aaatacaccg gtgatggtgc atatttacct       120
     gtaaatgtta atgagatgcg taaagcttta gcgttagaaa acacagcgga gcttccagac       180
     ttcggagagc tgtatacggt taatacaagc attaaaggac attgtaaaaa ctggaacgat       240
     actacctata gagaaattct tgatgttgcg aatcaaattg ttaattattc aagaagagcg       300
     gaagttttct atgcaccctt acttgattac ttaccggata ttttagaagg tgatactgtg       360
     gccttagaaa agtttcagaa aatttgcgaa aaattagcga aagaggcgaa agctttcagt       420
     gaccatgctg aaacattagc gaagaccgtt aaacagttcg ctgatgatac aacaaatgat       480
     tataaaaact taataaatgt taaggttaaa tatgatgcat tgtatggaaa aaatagcgaa       540
     gaagaaataa aacttagagc ggaagtaaaa aagttgcggg aagagttaga gaaatatata       600
     gaagattacg aagattacga atcggaatct tggttgtctt tattacttgg tcctgttttt       660
     ggttttatat taaagggaat tctcgacagt acgcatgggc aaatgttaaa ggctaaagtt       720
     gatgctacaa gacaaaaaat cgaagcaaca tgtgcaacta tacagcgaaa tgtttattta       780
     atgtctttac tcgataaggc agatgttgga actgataaaa cccaaaaaca aattgaggaa       840
     gctcttccag taattaataa aatcaaggcg atttggtctg ctcttcataa ggacctttta       900
     acactttcaa ctattacaat gaaagatatt catgatgatc cggaatttgc cgaccttgga       960
     attgaattag caattatgca atgggtaaaa gtaggtaaac aagcagatga tttccgaatt      1020
     aatgcagatg taggatatat acttgatcaa tatattgcat aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page